Mouse Anti-Rat Msrb1 Antibody (MO-AB-27269H)


Cat: MO-AB-27269H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Specifications
  • Application Information
  • Target

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus)
CloneMO27269C
SpecificityThis antibody binds to Rat Msrb1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Nucleus; Cytoskeleton

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene belongs to the methionine-R-sulfoxide reductase B (MsrB) family. Members of this family function as repair enzymes that protect proteins from oxidative stress by catalyzing the reduction of methionine-R-sulfoxides to methionines. This protein is highly expressed in liver and kidney, and is localized to the nucleus and cytosol. It is the only member of the MsrB family that is a selenoprotein, containing a selenocysteine (Sec) residue at its active site. It also has the highest methionine-R-sulfoxide reductase activity compared to other members containing cysteine in place of Sec. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. A pseudogene of this locus has been identified on chromosome 19.
Product OverviewThis product is a mouse antibody against Msrb1. It can be used for Msrb1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMethionine-R-sulfoxide reductase B1; MsrB1; EC 1.8.4.-; Selenoprotein X; SelX; Msrb1; Sepx1
UniProt IDQ52KJ8
Protein RefseqThe length of the protein is 116 amino acids long.
The sequence is show below: MSFCSFFGGEVFQNHFEPGVYVCAKCGYELFSSRSKYAHSSPWPAFTETIHEDSVAKCPEKNRPEALKVSCGKCGNGLGHEFLNDGPKRGQSRFUIFSSSLKFIPKGKEAPASQGD.
For Research Use Only | Not For Clinical Use.
Online Inquiry