Mouse Anti-Rice MSRB1 Antibody (CBMOAB-34730FYB)
Cat: CBMOAB-34730FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Specifications
- Application Information
- Target
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rice (Oryza) |
| Clone | MO34730FYB |
| Specificity | This antibody binds to Rice MSRB1. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Chloroplast; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The protein encoded by this gene belongs to the methionine-R-sulfoxide reductase B (MsrB) family. Members of this family function as repair enzymes that protect proteins from oxidative stress by catalyzing the reduction of methionine-R-sulfoxides to methionines. This protein is highly expressed in liver and kidney, and is localized to the nucleus and cytosol. It is the only member of the MsrB family that is a selenoprotein, containing a selenocysteine (Sec) residue at its active site. It also has the highest methionine-R-sulfoxide reductase activity compared to other members containing cysteine in place of Sec. Sec is encoded by the UGA codon, which normally signals translation termination. The 3' UTRs of selenoprotein mRNAs contain a conserved stem-loop structure, designated the Sec insertion sequence (SECIS) element, that is necessary for the recognition of UGA as a Sec codon, rather than as a stop signal. A pseudogene of this locus has been identified on chromosome 19. (From NCBI) |
| Product Overview | Mouse Anti-Rice MSRB1 Antibody is a mouse antibody against MSRB1. It can be used for MSRB1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Peptide methionine sulfoxide reductase B1, chloroplastic; OsMSRB1; EC 1.8.4.12; Peptide-methionine (R)-S-oxide reductase; MSRB1; Os06g0472000 LOC_Os06g27760 |
| UniProt ID | Q0DC89 |
| Protein Refseq | The length of the protein is 214 amino acids long. The sequence is show below: MAMRQYAAATAASSSFRARPRARPSCLPAAALPLAPCCGVAWSRASYRRASVRAMGAASSSSSSSSSSPSPQGQAQAQAQGKPNYSTSLTDEEWRKRLTKDQYYITRQKGTERAFTGEYWNTKTPGIYHCVCCDTPLFESSTKFDSGTGWPSYYQPIGDNVKCKLDMSIIFMPRTEVLCAVCDAHLGHVFDDGPRPTGKRYCINSASLKLKKTQ. |
See other products for " MsrB1 "
| MO-DKB-02225W | Rabbit Anti-MsrB1 Antibody (MO-DKB-02225W) |
| CBMOAB-36759FYC | Mouse Anti-Arabidopsis MSRB1 Antibody (CBMOAB-36759FYC) |
| MO-AB-16107R | Mouse Anti-Cattle MSRB1 Antibody (MO-AB-16107R) |
| CBMOAB-87573FYA | Mouse Anti-Zebrafish msrb1 Antibody (CBMOAB-87573FYA) |
| MO-AB-27269H | Mouse Anti-Rat Msrb1 Antibody (MO-AB-27269H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry