Mouse Anti-Rhesus BMP4 Antibody (CBMOAB-37013FYA)


Cat: CBMOAB-37013FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO37013FYA
SpecificityThis antibody binds to Rhesus BMP4.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a secreted ligand of the TGF-beta (transforming growth factor-beta) superfamily of proteins. Ligands of this family bind various TGF-beta receptors leading to recruitment and activation of SMAD family transcription factors that regulate gene expression. The encoded preproprotein is proteolytically processed to generate each subunit of the disulfide-linked homodimer. This protein regulates heart development and adipogenesis. Mutations in this gene are associated with orofacial cleft and microphthalmia in human patients. The encoded protein may also be involved in the pathology of multiple cardiovascular diseases and human cancers.
Product OverviewMouse Anti-Rhesus BMP4 Antibody is a mouse antibody against BMP4. It can be used for BMP4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesBone morphogenetic protein 4 preproprotein; BMP4
UniProt IDH9F019
Protein RefseqThe length of the protein is 233 amino acids long.
The sequence is show below: MIPGNRMLMVVLLCQVLLGGASHASLIPETGKKKVAEIQGHAGGRRSGQSHELLRDFEATLLQMFGLRRRPQPSKSAVIPDYMRDLYRLQSGEEEEEQIHSAGLEYPERPASRANTVRSFHHEEHLENIPGTSENSAFRFLFNLSSIPENEVISSAELRLFREQVDQGPDWERGFHRINIYEVMKPPAEVVPGHLITRLLDTRLVHHNVTRWETFDVSPAVLRRTREKQPNYG.
See other products for " bmp4 "
CBMOAB-67779FYAMouse Anti-Zebrafish bmp4 Antibody (CBMOAB-67779FYA)
MO-AB-36788WMouse Anti-Goat bmp4 Antibody (MO-AB-36788W)
MO-AB-07357YMouse Anti-Rabbit BMP4 Antibody (MO-AB-07357Y)
MO-AB-00153RMouse Anti-Medaka bmp4 Antibody (MO-AB-00153R)
MO-AB-01890HMouse Anti-Frog bmp4 Antibody (MO-AB-01890H)
MO-DKB-00288WRabbit Anti-BMP4 Antibody (MO-DKB-00288W)
MO-AB-51901WMouse Anti-Marmoset BMP4 Antibody (MO-AB-51901W)
MOFY-0622-FY62Rabbit Anti-BMP4 Antibody (MOFY-0622-FY62)
MOFY-0722-FY387Rabbit Anti-BMP4 Antibody (MOFY-0722-FY387)
MO-AB-00877YMouse Anti-Chicken BMP4 Antibody (MO-AB-00877Y)
For Research Use Only | Not For Clinical Use.
Online Inquiry