Mouse Anti-Silkworm ace Antibody (MO-AB-68743W)


Cat: MO-AB-68743W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivitySilkworm (Bombyx mori)
CloneMO68743W
SpecificityThis antibody binds to Silkworm ace.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes an enzyme involved in catalyzing the conversion of angiotensin I into a physiologically active peptide angiotensin II. Angiotensin II is a potent vasopressor and aldosterone-stimulating peptide that controls blood pressure and fluid-electrolyte balance. This enzyme plays a key role in the renin-angiotensin system. Many studies have associated the presence or absence of a 287 bp Alu repeat element in this gene with the levels of circulating enzyme or cardiovascular pathophysiologies. Multiple alternatively spliced transcript variants encoding different isoforms have been identified, and two most abundant spliced variants encode the somatic form and the testicular form, respectively, that are equally active.
Product OverviewMouse Anti-Silkworm ace (clone MO68743W) Antibody (MO-AB-68743W) is a mouse antibody against ace. It can be used for ace detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAcetylcholinesterase; ace
UniProt IDQ2QDG2
Protein RefseqThe length of the protein is 638 amino acids long.
The sequence is show below: MINYGKIVFTKLLLCVLISGTFARSWANHHDTTTSTTQTTPTTSPVPKNIHNDPLIVETKSGLIKGYAKTVMGREVHIFTGIPFAKPPLGPLRFRKPVPIEPWHGVLEANLMPNSCYQERYEYFPGFEGEEMWNPNTNISEDCLYLNIWVPQHLRVRHHQDKPLAERPKVPILVWIYGGGYMSGTATLDLYKADIMASTSDVIVASMQYRVGAFGFLYLNKYFSPGSEEAPGNMGLWDQQLAIRWIKENARAFGGDPELITLFGESAGGGSVSLHMLSPEMKGLFKRGILQSGTLNAPWSWMTGERAQDIGKVLIDDCNCNSSLLAKDPSLVMDCMRGVDAKTISVQQWNSYTGILGFPSAPTVDGIFLPKDPDTMMKEGNFHNSEVLLGSNQDEGTYFLLYDFLDYFEKDGPSFLQREKFLEIVDTIFKDFSKIKREAIVFQYTDWEEITDGYLNQKMIADVVGDYFFVCPTNYFAEILADAGVDVYYYYFTHRTSTSLWGEWMGVMHGDEMEYVFGHPLNMSLQYHSRERDLAAHIMQSFTQFALTGKPHKPDEKWPLYSRSSPHYYTYTAVGPSGPAGPRGPRASACAFWNDFLNKLNELERVPCDGAVTGPYSSVAGTALPVTLLTTLAITIAL.
For Research Use Only | Not For Clinical Use.

Online Inquiry