Mouse Anti-Tomato AGO1 Antibody (MO-AB-34120H)


Cat: MO-AB-34120H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityTomato (Lycopersicon esculentum)
CloneMO34120C
SpecificityThis antibody binds to Tomato AGO1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon.
Product OverviewThis product is a mouse antibody against AGO1. It can be used for AGO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesArgonaute 1; AGO1
UniProt IDB6EBK3
Protein RefseqThe length of the protein is 73 amino acids long.
The sequence is show below: LVPPAYYAHLAAFRARFYMEPETSDGGSVTSGAAPYRGGVGAVGRSTRAPGVGAAVRPLPALKENVKRVMFYC.
For Research Use Only | Not For Clinical Use.
Online Inquiry