Mouse Anti-Tomato AGO1 Antibody (MO-AB-34120H)
Cat: MO-AB-34120H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Tomato (Lycopersicon esculentum) |
Clone | MO34120C |
Specificity | This antibody binds to Tomato AGO1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the argonaute family of proteins, which associate with small RNAs and have important roles in RNA interference (RNAi) and RNA silencing. This protein binds to microRNAs (miRNAs) or small interfering RNAs (siRNAs) and represses translation of mRNAs that are complementary to them. It is also involved in transcriptional gene silencing (TGS) of promoter regions that are complementary to bound short antigene RNAs (agRNAs), as well as in the degradation of miRNA-bound mRNA targets. Alternatively spliced transcript variants encoding different isoforms have been found for this gene. A recent study showed this gene to be an authentic stop codon readthrough target, and that its mRNA could give rise to an additional C-terminally extended isoform by use of an alternative in-frame translation termination codon. |
Product Overview | This product is a mouse antibody against AGO1. It can be used for AGO1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Argonaute 1; AGO1 |
UniProt ID | B6EBK3 |
Protein Refseq | The length of the protein is 73 amino acids long. The sequence is show below: LVPPAYYAHLAAFRARFYMEPETSDGGSVTSGAAPYRGGVGAVGRSTRAPGVGAAVRPLPALKENVKRVMFYC. |
See other products for " AGO1 "
MO-AB-23620R | Mouse Anti-Pig AGO1 Antibody (MO-AB-23620R) |
MO-AB-68776W | Mouse Anti-Silkworm Ago1 Antibody (MO-AB-68776W) |
CBMOAB-1839FYC | Mouse Anti-Arabidopsis AGO1 Antibody (CBMOAB-1839FYC) |
MO-AB-38433W | Mouse Anti-Gorilla AGO1 Antibody (MO-AB-38433W) |
MO-AB-22820H | Mouse Anti-Mallard AGO1 Antibody (MO-AB-22820H) |
MO-AB-43607W | Mouse Anti-Horse AGO1 Antibody (MO-AB-43607W) |
MOFAB-692W | Mouse Anti-Ago1 Antibody (MOFAB-692W) |
MO-AB-14132Y | Mouse Anti-Sheep AGO1 Antibody (MO-AB-14132Y) |
CBMOAB-00760FYA | Mouse Anti-D. melanogaster Ago1 Antibody (CBMOAB-00760FYA) |
MO-DKB-03977W | Rabbit Anti-AGO1 (C-terminal) Antibody (Cat MO-DKB-03977W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry