Rabbit Anti-Wnt10a (Center) Antibody (Cat MO-DKB-03351W)
Cat: MO-DKB-03351W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Rabbit (Oryctolagus cuniculus) |
| Species Reactivity | Human (Homo sapiens), Rabbit (Oryctolagus cuniculus), Mouse (Mus musculus), Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Guinea pig (Cavia porcllus), Zebrafish (Danio rerio) |
| Specificity | This antibody is binds to Human Wnt-10a and has cross reactivity with Rabbit, Mouse, Rat, Cattle, Dog, Guinea pig, Zebrafish Wnt-10a. |
| Immunogen | The synthetic peptide corresponding to Wnt10a (without wing-related MMTV integration site 10a) The peptide sequence is selected from the middle region of Wnt10a. Peptide sequence RDQRWNCSSLETRNKVPYESPIFSRGFRESAFAYAIAAAGVVHAVSNACA. The peptide sequence of the immunogen was taken from the region. |
| Epitope | Center |
| Format | Liquid or Lyophilized |
| Buffer | PBS, 2% Sucrose |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purification | Affinity purified |
Application Information
| Application | WB, IHC, IHC-P |
| Application Notes | Western Blot: 1.0 ug/mL Immunohistochemistry: 1:10-1:500 Immunohistochemistry-Paraffin: 1:10-1:500 The optimal dilution should be determined by the end user. |
Target
| Introduction | The WNT gene family consists of structurally related genes which encode secreted signaling proteins. These proteins have been implicated in oncogenesis and in several developmental processes, including regulation of cell fate and patterning during embryogenesis. This gene is a member of the WNT gene family. It is strongly expressed in the cell lines of promyelocytic leukemia and Burkitt's lymphoma. In addition, it and another family member, the WNT6 gene, are strongly coexpressed in colorectal cancer cell lines. The gene overexpression may play key roles in carcinogenesis through activation of the WNT-beta-catenin-TCF signaling pathway. This gene and the WNT6 gene are clustered in the chromosome 2q35 region. |
| Product Overview | This product is a Rabbit antibody against the Wnt-10a. It can be used for Wnt-10a detection in Western Blot, Immunohistochemistry, Immunohistochemistry-Paraffin. |
| Alternative Names | Protein Wnt; wnt10 |
| UniProt ID | B0V1G8 |
See other products for " WNT10A "
| MO-AB-18312W | Mouse Anti-Chimpanzee WNT10A Antibody (MO-AB-18312W) |
| MO-AB-01675L | Mouse Anti-Elephant WNT10A Antibody (MO-AB-01675L) |
| MO-AB-35980W | Mouse Anti-Ferret WNT10A Antibody (MO-AB-35980W) |
| MO-AB-31248R | Mouse Anti-Pig WNT10A Antibody (MO-AB-31248R) |
| MO-AB-08538W | Mouse Anti-Cat WNT10A Antibody (MO-AB-08538W) |
| MO-AB-09139H | Mouse Anti-Frog wnt10a Antibody (MO-AB-09139H) |
| MO-AB-10490Y | Mouse Anti-Rabbit WNT10A Antibody (MO-AB-10490Y) |
| MO-AB-34057W | Mouse Anti-Dog WNT10A Antibody (MO-AB-34057W) |
| MO-AB-18252Y | Mouse Anti-Sheep WNT10A Antibody (MO-AB-18252Y) |
| MO-AB-01920R | Mouse Anti-Medaka wnt10a Antibody (MO-AB-01920R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry