Mouse Anti-Zebrafish akt1 Antibody (CBMOAB-65413FYA)


Cat: CBMOAB-65413FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO65413FYA
SpecificityThis antibody binds to Zebrafish akt1.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe serine-threonine protein kinase encoded by the AKT1 gene is catalytically inactive in serum-starved primary and immortalized fibroblasts. AKT1 and the related AKT2 are activated by platelet-derived growth factor. The activation is rapid and specific, and it is abrogated by mutations in the pleckstrin homology domain of AKT1. It was shown that the activation occurs through phosphatidylinositol 3-kinase. In the developing nervous system AKT is a critical mediator of growth factor-induced neuronal survival. Survival factors can suppress apoptosis in a transcription-independent manner by activating the serine/threonine kinase AKT1, which then phosphorylates and inactivates components of the apoptotic machinery. Mutations in this gene have been associated with the Proteus syndrome. Multiple alternatively spliced transcript variants have been found for this gene.
Product OverviewMouse Anti-Zebrafish akt1 Antibody is a mouse antibody against akt1. It can be used for akt1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAkt1; akt
UniProt IDM4MD44
Protein RefseqThe length of the protein is 474 amino acids long.
The sequence is show below: MATDVVIVKEGWLHKRGEYIKTWRPRYFLLKSDGTFIGYKERPQDVDQLETPLNNFSVAQCQLMKTERPKPNTFIIRCLQWTTVIERTFHVETPEERQEWTKAIQTVAESLQKQEEEMMDASAEHTDMETSLSKPPHKVTMHDFEYLKLLGKGTFGKVILVKEKATGKYYAMKILKKEVIVAKDEVAHTLTENRVLQNSRHPFLTALKSSFQTHDHLCFVMEYANGGELFFHLSRERVFSEERACFYGAEIVSALHYLHSERNVVYRDLKLENLMLDKDGHVKITDFGLCKEGITDGATMKTFCGTPEYLAPEVLEDNDYGRAVDWWGLGVVMYEMMCGRLPFYNQDHERLFELILMEDIRFPRTLAPDAKSLLSGLLKKDPMQRLGGGPDDAKEIMQHKFFTGIVWQDVYEKKLVPPFKPQVTSETDTRYFDEEFTGQTITITPPGQDDCMEAFDSERRPHFPQFSYSASGTA.
For Research Use Only | Not For Clinical Use.
Online Inquiry