Mouse Anti-Zebrafish arnt Antibody (CBMOAB-66566FYA)


Cat: CBMOAB-66566FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO66566FYA
SpecificityThis antibody binds to Zebrafish arnt.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a protein containing a basic helix-loop-helix domain and two characteristic PAS domains along with a PAC domain. The encoded protein binds to ligand-bound aryl hydrocarbon receptor and aids in the movement of this complex to the nucleus, where it promotes the expression of genes involved in xenobiotic metabolism. This protein is also a co-factor for transcriptional regulation by hypoxia-inducible factor 1. Chromosomal translocation of this locus with the ETV6 (ets variant 6) gene on chromosome 12 have been described in leukemias. Alternative splicing results in multiple transcript variants.
Product OverviewMouse Anti-Zebrafish arnt Antibody is a mouse antibody against arnt. It can be used for arnt detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Namesarnt; Aryl Hydrocarbon Receptor Nuclear Translocator
UniProt IDE7FDK6
Protein RefseqThe length of the protein is 746 amino acids long.
The sequence is show below: MTSANPDMSEVPSLAMTSSNGSHSNGVQKANKRQATSDYEDDEGGKLFRCDDDGGGSNDKERFARENHSEIERRRRNKMTAYITELSDMVPACSALARKPDKLTILRMAVSHMKSLRGTGNTSTDGTYKPSFLTDQELKHLILEAADGFLFVVSCETGRVVYVSDSVTPVLNQAQSDWLGSSLYDQLHPDDVEKLREQLSTTENNNNSGRMLDMKTGTVKKEGGQATVRMSMGARRSFICRMRCGVCPVEPVSLNRLNFLRTRNRNGLGSAKDGEQQYVVVHCTGYIRSWPPAGMNLSEEEADNNQGNRFCLVAIGRLQVTCCPSDTSINNISVPVEFISRHNSQGVYTFVDHRCTATVGFQTQELLGKNILDFAHPEDQGLLRDSLQQVVKLRGQVMSVMFRFQSKSREWVWMRTSSFTFQNPFSEEIEYIICTNTNVNRGSSEGSVSPLSSPSLGQSPNCPSTPSPGCVTVRQLQQQQVELDGGGMSQEAPYENSQVTLPQVSVQTCGVVSADHSSKAVSSSVSSGQQVYPPAAAFPSPARPTETFRSPVLPQQMVSVAHSAGQMLAQMSRQSTPSGVSGSNNSPIQAPSGPTAPPGLWSTTRQPFSTQVAGPIGKNQSAPFNMGGFSSASAPSTSSSFGQMGGASASMASTSSYQQINSHSNPSTNGYGDVGQMAAAFGSRPAEGVTGWQQWPSQTHTQASADTQVQNNQTDIFPDVLSMLDQSGSFSNGDFSEMPMFPPFPE.
For Research Use Only | Not For Clinical Use.
Online Inquiry