Mouse Anti-Zebrafish map1lc3b Antibody (CBMOAB-85821FYA)


Cat: CBMOAB-85821FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO85821FYA
SpecificityThis antibody binds to Zebrafish map1lc3b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.
Product OverviewMouse Anti-Zebrafish map1lc3b Antibody is a mouse antibody against map1lc3b. It can be used for map1lc3b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMap1lc3b protein; Microtubule-associated protein 1 light chain 3 beta; Microtubule-associated protein 1-light chain 3B; map1lc3b; MAP1-LC3
UniProt IDQ7ZUD8
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MPSEKTFKQRRTFEQRVEDVRLIREQHPNKIPVIIERYKGEKQLPILDKTKFLVPDHVNMSELIKIIRRRLQLNSNQAFFLLVNGHSMVSVSTAISEVYERERDEDGFLYMVYASQETFGFQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry