Connect with Us at the Upcoming Events

Creative Biolabs is excited to greet you at the upcoming international conferences. Meet our team at the 13th Annual World ADC San Diego and the 13th Annual World Multispecific Summit in September (booth number to be updated) for expert consultation on your drug discovery. Shoot an email to arrange an in-person meeting!

Mouse Anti-Zebrafish map1lc3b Antibody (CBMOAB-85821FYA)


Cat: CBMOAB-85821FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio)
CloneMO85821FYA
SpecificityThis antibody binds to Zebrafish map1lc3b.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component.
Product OverviewMouse Anti-Zebrafish map1lc3b (clone MO85821FYA) Antibody (CBMOAB-85821FYA) is a mouse antibody against map1lc3b. It can be used for map1lc3b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMap1lc3b protein; Microtubule-associated protein 1 light chain 3 beta; Microtubule-associated protein 1-light chain 3B; map1lc3b; MAP1-LC3
UniProt IDQ7ZUD8
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MPSEKTFKQRRTFEQRVEDVRLIREQHPNKIPVIIERYKGEKQLPILDKTKFLVPDHVNMSELIKIIRRRLQLNSNQAFFLLVNGHSMVSVSTAISEVYERERDEDGFLYMVYASQETFGFQ.
For Research Use Only | Not For Clinical Use.

Online Inquiry