Mouse Anti-MAP1LC3B Antibody (MO-AB-15301R)
Cat: MO-AB-15301R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| MO-AB-15301R | Monoclonal | Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Fish, Frog (Xenopus), Zebrafish (Danio rerio), Marmoset, Medaka (Oryzias latipes) | WB, ELISA | MO15301R | 100 µg | ||
| MO-AB-21877W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21877W | 100 µg | ||
| MO-AB-58601W | Monoclonal | Marmoset | WB, ELISA | MO58601W | 100 µg | ||
| MO-AB-00863R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00863R | 100 µg | ||
| MO-AB-27126R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27126R | 100 µg | ||
| MO-AB-04992H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04992C | 100 µg | ||
| MO-NAB-00358W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Fish, Frog (Xenopus), Zebrafish (Danio rerio) | WB, FC, FC-IC, IF, IHC, IHC-Fr, IHC-P, IP, KO | NW0284 | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Fish, Frog (Xenopus), Zebrafish (Danio rerio), Marmoset, Medaka (Oryzias latipes) |
| Clone | MO15301R |
| Specificity | This antibody binds to Cattle MAP1LC3B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Lysosome; Cytosol; Cytoskeleton |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | It is observed enhanced LC3B and other autophagy-related molecules by inducing oxidative stress in OC cells using ROS-generating pro-oxidant molecules. Enhanced LC3B fails to induce autophagosome formation, possibly due to reduced ULK1 complexes. ROS-induced enhanced LC3B also increased apoptosis. Furthermore, LC3B inhibits cell adhesion molecules/mesenchymal markers, leading to anoikis. Furthermore, in vitro studies showed that ROS-dependent enhanced LC3B reduced tumor growth. Similar effects were observed with primary cells from patients. Here, we demonstrate the unique role of LC3B in in vitro/in vivo/ex vivo induction of anoikis. |
| Product Overview | Mouse Anti-Cattle MAP1LC3B Antibody is a mouse antibody against MAP1LC3B. It can be used for MAP1LC3B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Microtubule-associated proteins 1A/1B light chain 3B; Autophagy-related protein LC3 B; Autophagy-related ubiquitin-like modifier LC3 B; MAP1 light chain 3-like protein 2; MAP1A/MAP1B light chain 3 B; MAP1A/MAP1B LC3 B; Microtubule-associated protein 1 lig癷?癸MAP1LC3B; MAP1ALC3 MAP1LC3 |
| UniProt ID | O41515 |
| Protein Refseq | The length of the protein is 125 amino acids long. The sequence is show below: MPSEKTFKQRRTFEQRVEDVRLIREQHPTKIPVIIERYKGEKQLPVLDKTKFLVPDHVNMSELIKIIRRRLQLNANQAFFLLVNGHSMVSVSTPICEVYESEKDEDGFLYMVYASQETFGMKLSV. |
See other products for " map1lc3b "
| CBMOAB-85821FYA | Mouse Anti-map1lc3b Antibody (CBMOAB-85821FYA) |
| MOFAB-028W | Rabbit Anti-map1lc3b Antibody (MOFAB-028W) |
| MO-AB-26961H | Mouse Anti-Map1lc3b Antibody (MO-AB-26961H) |
| MO-DKB-03266W | Rabbit Anti-MAP1LC3B (N-terminal) Antibody (Cat MO-DKB-03266W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry