Mouse Anti-map1lc3b Antibody (CBMOAB-85821FYA)
Cat: CBMOAB-85821FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-85821FYA | Monoclonal | Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Fish, Frog (Xenopus), Marmoset, Medaka (Oryzias latipes) | WB, ELISA | MO85821FYA | 100 µg | ||
| MO-AB-21877W | Monoclonal | Chimpanzee (Pan troglodytes) | WB, ELISA | MO21877W | 100 µg | ||
| MO-AB-58601W | Monoclonal | Marmoset | WB, ELISA | MO58601W | 100 µg | ||
| MO-AB-00863R | Monoclonal | Medaka (Oryzias latipes) | WB, ELISA | MO00863R | 100 µg | ||
| MO-AB-27126R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO27126R | 100 µg | ||
| MO-AB-04992H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO04992C | 100 µg | ||
| MO-NAB-00358W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Fish, Frog (Xenopus), Zebrafish (Danio rerio) | WB, FC, FC-IC, IF, IHC, IHC-Fr, IHC-P, IP, KO | NW0284 | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Fish, Frog (Xenopus), Marmoset, Medaka (Oryzias latipes) |
| Clone | MO85821FYA |
| Specificity | This antibody binds to Zebrafish map1lc3b. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Cytosol |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | The product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component. |
| Product Overview | Mouse Anti-Zebrafish map1lc3b Antibody is a mouse antibody against map1lc3b. It can be used for map1lc3b detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Map1lc3b protein; Microtubule-associated protein 1 light chain 3 beta; Microtubule-associated protein 1-light chain 3B; map1lc3b; MAP1-LC3 |
| UniProt ID | Q7ZUD8 |
| Protein Refseq | The length of the protein is 122 amino acids long. The sequence is show below: MPSEKTFKQRRTFEQRVEDVRLIREQHPNKIPVIIERYKGEKQLPILDKTKFLVPDHVNMSELIKIIRRRLQLNSNQAFFLLVNGHSMVSVSTAISEVYERERDEDGFLYMVYASQETFGFQ. |
See other products for " Map1lc3b "
| MO-AB-26961H | Mouse Anti-Map1lc3b Antibody (MO-AB-26961H) |
| MO-DKB-03266W | Rabbit Anti-MAP1LC3B (N-terminal) Antibody (Cat MO-DKB-03266W) |
| MOFAB-028W | Rabbit Anti-map1lc3b Antibody (MOFAB-028W) |
| MO-AB-15301R | Mouse Anti-MAP1LC3B Antibody (MO-AB-15301R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry