Mouse Anti-map1lc3b Antibody (CBMOAB-85821FYA)


Cat: CBMOAB-85821FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-85821FYA Monoclonal Zebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Fish, Frog (Xenopus), Marmoset, Medaka (Oryzias latipes) WB, ELISA MO85821FYA 100 µg
MO-AB-21877W Monoclonal Chimpanzee (Pan troglodytes) WB, ELISA MO21877W 100 µg
MO-AB-58601W Monoclonal Marmoset WB, ELISA MO58601W 100 µg
MO-AB-00863R Monoclonal Medaka (Oryzias latipes) WB, ELISA MO00863R 100 µg
MO-AB-27126R Monoclonal Pig (Sus scrofa) WB, ELISA MO27126R 100 µg
MO-AB-04992H Monoclonal Frog (Xenopus laevis) WB, ELISA MO04992C 100 µg
MO-NAB-00358W Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Fish, Frog (Xenopus), Zebrafish (Danio rerio) WB, FC, FC-IC, IF, IHC, IHC-Fr, IHC-P, IP, KO NW0284 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Chimpanzee (Pan troglodytes), Frog (Xenopus laevis), Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Pig (Sus scrofa), Cattle (Bos taurus), Fish, Frog (Xenopus), Marmoset, Medaka (Oryzias latipes)
CloneMO85821FYA
SpecificityThis antibody binds to Zebrafish map1lc3b.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytosol

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe product of this gene is a subunit of neuronal microtubule-associated MAP1A and MAP1B proteins, which are involved in microtubule assembly and important for neurogenesis. Studies on the rat homolog implicate a role for this gene in autophagy, a process that involves the bulk degradation of cytoplasmic component. (From uniprot, under CC BY 4.0)
Product OverviewMouse Anti-Zebrafish map1lc3b Antibody is a mouse antibody against map1lc3b. It can be used for map1lc3b detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMap1lc3b protein; Microtubule-associated protein 1 light chain 3 beta; Microtubule-associated protein 1-light chain 3B; map1lc3b; MAP1-LC3
UniProt IDQ7ZUD8
Protein RefseqThe length of the protein is 122 amino acids long.
The sequence is show below: MPSEKTFKQRRTFEQRVEDVRLIREQHPNKIPVIIERYKGEKQLPILDKTKFLVPDHVNMSELIKIIRRRLQLNSNQAFFLLVNGHSMVSVSTAISEVYERERDEDGFLYMVYASQETFGFQ.
For Research Use Only | Not For Clinical Use.
Online Inquiry