Mouse Anti-Zebrafish TLR4 Antibody (CBMOAB-09569FYB)
Cat: CBMOAB-09569FYB
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Zebrafish (Danio rerio) |
Clone | MO09569FYB |
Specificity | This antibody binds to Zebrafish TLR4. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the Toll-like receptor (TLR) family which plays a fundamental role in pathogen recognition and activation of innate immunity. TLRs are highly conserved from Drosophila to humans and share structural and functional similarities. They recognize pathogen-associated molecular patterns that are expressed on infectious agents, and mediate the production of cytokines necessary for the development of effective immunity. The various TLRs exhibit different patterns of expression. This receptor has been implicated in signal transduction events induced by lipopolysaccharide (LPS) found in most gram-negative bacteria. Mutations in this gene have been associated with differences in LPS responsiveness. Multiple transcript variants encoding different isoforms have been found for this gene. |
Product Overview | Mouse Anti-Zebrafish TLR4 Antibody is a mouse antibody against TLR4. It can be used for TLR4 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Toll-like receptor 4; TLR |
UniProt ID | S5Q1H4 |
Protein Refseq | The length of the protein is 74 amino acids long. The sequence is show below: YLRYCWILLRGYRSPGQQECSYDAFVIFSSYDEAWVMNELMENLEVGALPIRFCLHMRDFQAGKSIASNDIDEG. |
See other products for " TLR4 "
MO-AB-08772W | Mouse Anti-Cat TLR4 Antibody (MO-AB-08772W) |
MO-AB-29488H | Mouse Anti-Rat Tlr4 Antibody (MO-AB-29488H) |
MO-DKB-00601W | Rabbit Anti-TLR4 Antibody (MO-DKB-00601W) |
MO-AB-35838W | Mouse Anti-Ferret TLR4 Antibody (MO-AB-35838W) |
MO-AB-38311W | Mouse Anti-Goat TLR4 Antibody (MO-AB-38311W) |
MO-DKB-00588W | Rabbit Anti-TLR4 Antibody (MO-DKB-00588W) |
MO-AB-30726R | Mouse Anti-Pig TLR4 Antibody (MO-AB-30726R) |
MO-AB-43480W | Mouse Anti-Hamsters TLR4 Antibody (MO-AB-43480W) |
MO-AB-20642W | Mouse Anti-Chimpanzee TLR4 Antibody (MO-AB-20642W) |
MO-AB-66275W | Mouse Anti-Marmoset TLR4 Antibody (MO-AB-66275W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry