Mouse Anti-Arabidopsis ATPE Antibody (CBMOAB-24879FYC)


Cat: CBMOAB-24879FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityA. thaliana (Arabidopsis thaliana)
CloneMO24879FC
SpecificityThis antibody binds to Arabidopsis ATPE.
FormatLyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionProduces ATP from ADP in the presence of a proton gradient across the membrane.
Product OverviewMouse Anti-Arabidopsis ATPE (clone MO24879FC) Antibody (CBMOAB-24879FYC) is a mouse antibody against ATPE. It can be used for ATPE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase epsilon chain, chloroplastic; ATP synthase F1 sector epsilon subunit; F-ATPase epsilon subunit; atpE; AtCg00470
UniProt IDP09468
Protein RefseqThe length of the protein is 132 amino acids long. The sequence is show below: MTLNLCVLTPNRIVWDSEVKEIILSTNSGQIGVLANHAPIATAVDIGILKIRLANQWLTMALMGGFARIGNNEITILVNDAEKNSDIDPQEAQQTLEIAEANLRKAEGKRQTIEANLALRRARTRVEALNTI.
For Research Use Only | Not For Clinical Use.

Online Inquiry