Mouse Anti-Barrel medic atpE Antibody (MO-AB-00042W)


Cat: MO-AB-00042W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityBarrel medic (Medicago truncatula)
CloneMO00042W
SpecificityThis antibody binds to Barrel medic atpE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFF ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F containing the extramembraneous catalytic core and F containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
Product OverviewMouse Anti-Barrel medic atpE Antibody is a mouse antibody against atpE. It can be used for atpE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase CF1 epsilon subunit; atpE
UniProt IDS4SYZ7
Protein RefseqThe length of the protein is 136 amino acids long.
The sequence is show below: MTLNLCVLTPNRTVWDSEVKEIILSTNSGQIGVLKNHAPIATALDIGILKIRLNNNNRQWVTMALMGGFARIGNNEITILVNDAEKSIDIDPQEAQQTLKIAEANLNKAEGKRQKIEANLALRRAMTRVEAINRIS.

Reference

For Research Use Only | Not For Clinical Use.

Online Inquiry