Mouse Anti-Grape atpE Antibody (MO-AB-38863W)


Cat: MO-AB-38863W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGrape (Vitis vinifera)
CloneMO38863W
SpecificityThis antibody binds to Grape atpE.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationChloroplast; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionFF ATP synthase produces ATP from ADP in the presence of a proton or sodium gradient. F-type ATPases consist of two structural domains, F containing the extramembraneous catalytic core and F containing the membrane proton channel, linked together by a central stalk and a peripheral stalk. During catalysis, ATP synthesis in the catalytic domain of F is coupled via a rotary mechanism of the central stalk subunits to proton translocation.
Product OverviewMouse Anti-Grape atpE Antibody is a mouse antibody against atpE. It can be used for atpE detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesATP synthase epsilon chain, chloroplastic; atpE
UniProt IDQ8M8T9
Protein RefseqThe length of the protein is125 amino acids long.
The sequence is show below: TPNRIVWDSKVKEIILSTNSGQIGILPNHAPIATAVDIGILRIRLNDQWLTMALMGGFARIGNNEITVLVNDAEKGSDIEPQEAQQTLEIAEANLRKAEGKRQIIEANLALRRARTRVEAINVTS.
See other products for " AtpE "
MO-DKB-01641WRabbit Anti-AtpE Antibody (MO-DKB-01641W)
MO-AB-30218HMouse Anti-Sugar beet atpE Antibody (MO-AB-30218H)
CBMOAB-0216YCMouse Anti-E. coli atpE Antibody (CBMOAB-0216YC)
CBMOAB-24879FYCMouse Anti-Arabidopsis ATPE Antibody (CBMOAB-24879FYC)
MO-AB-27245WMouse Anti-Cottonwood atpE Antibody (MO-AB-27245W)
MO-AB-36078WMouse Anti-French-bean atpE Antibody (MO-AB-36078W)
CBMOAB-18721FYBMouse Anti-Rice atpE Antibody (CBMOAB-18721FYB)
MO-AB-00042WMouse Anti-Barrel medic atpE Antibody (MO-AB-00042W)
MOFAB-289WRabbit Anti-ATPE Antibody (MOFAB-289W)
MO-AB-01780LMouse Anti-Bromus AtpE Antibody (MO-AB-01780L)
For Research Use Only | Not For Clinical Use.
Online Inquiry