Mouse Anti-Arabidopsis CBL Antibody (CBMOAB-25772FYC)
Cat: CBMOAB-25772FYC
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | A. thaliana (Arabidopsis thaliana) |
| Clone | MO25772FC |
| Specificity | This antibody binds to Arabidopsis CBL. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene is a proto-oncogene that encodes a RING finger E3 ubiquitin ligase. The encoded protein is one of the enzymes required for targeting substrates for degradation by the proteasome. This protein mediates the transfer of ubiquitin from ubiquitin conjugating enzymes (E2) to specific substrates. This protein also contains an N-terminal phosphotyrosine binding domain that allows it to interact with numerous tyrosine-phosphorylated substrates and target them for proteasome degradation. As such it functions as a negative regulator of many signal transduction pathways. This gene has been found to be mutated or translocated in many cancers including acute myeloid leukaemia, and expansion of CGG repeats in the 5' UTR has been associated with Jacobsen syndrome. Mutations in this gene are also the cause of Noonan syndrome-like disorder. |
| Product Overview | Mouse Anti-Arabidopsis CBL Antibody is a mouse antibody against CBL. It can be used for CBL detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Cbl Proto-Oncogene; Cas-Br-M (Murine) Ecotropic Retroviral Transforming Sequence; Cbl Proto-Oncogene, E3 Ubiquitin Protein Ligase; Casitas B-Lineage Lymphoma Proto-Oncogene; RING-Type E3 Ubiquitin Transferase CBL; Signal Transduction Protein CBL; RING Finger Protein 55; Proto-Oncogene C-Cbl; Oncogene CBL2; RNF55 |
| UniProt ID | F4J244 |
| Protein Refseq | The length of the protein is 378 amino acids long. The sequence is show below: MTSSLSLHSSFVPSFADLSDRGLISKNSPTSVSISKVPTWEKKQISNRNSFKLNCVMEKSVDGQTHSTVNNTTDSLNTMNIKEEASVSTLLVNLDNKFDPFDAMSTPLYQTATFKQPSAIENGPYDYTRSGNPTRDALESLLAKLDKADRAFCFTSGMAALSAVTHLIKNGEEIVAGDDVYGGSDRLLSQVVPRSGVVVKRVNTTKLDEVAAAIGPQTKLVWLESPTNPRQQISDIRKISEMAHAQGALVLVDNSIMSPVLSRPLELGADIVMHSATKFIAGHSDVMAGVLAVKGEKLAKEVYFLQNSEGSGLAPFDCWLCLRGIKTMALRIEKQQENARKIAMYLSSHPRVKKVYYAGLPDHPGHHLHFSQVLKSIN. |
See other products for " CBL "
| MO-AB-52306W | Mouse Anti-Marmoset CBL Antibody (MO-AB-52306W) |
| MO-AB-00333H | Mouse Anti-Arabidopsis CBL Antibody (MO-AB-00333H) |
| MO-AB-12174W | Mouse Anti-Chimpanzee CBL Antibody (MO-AB-12174W) |
| MO-AB-34246H | Mouse Anti-Tomato cbl Antibody (MO-AB-34246H) |
| MO-AB-02332W | Mouse Anti-Fruit fly Cbl Antibody (MO-AB-02332W) |
| MO-AB-02112H | Mouse Anti-Frog Cbl Antibody (MO-AB-02112H) |
| CBMOAB-0315YC | Mouse Anti-E. coli cbl Antibody (CBMOAB-0315YC) |
| MO-DKB-01359W | Rabbit Anti-CBL Antibody (MO-DKB-01359W) |
| CBMOAB-69164FYA | Mouse Anti-Zebrafish cbl Antibody (CBMOAB-69164FYA) |
| MO-NAB-00758W | Mouse Anti-Drosophila Cbl Antibody (Full length) |
For Research Use Only | Not For Clinical Use.
Online Inquiry