Mouse Anti-bdnf Antibody (CBMOAB-67619FYA)
Cat: CBMOAB-67619FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
- Product List
- Specifications
- Application Information
- Target
| Sub Cat | Clonality | Species Reactivity | Application | Clone | Conjugate | Size | |
| CBMOAB-67619FYA | Monoclonal | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Dog, Human, Mouse, Rat, Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Primat, Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Mallard (Anas platyrhynchos), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO67619FYA | 100 µg | ||
| CBMOAB-00274FYA | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, IHC, IF | F00274FYA | 100 µg | ||
| CBMOAB-36905FYA | Monoclonal | Rhesus (Macaca mulatta) | WB, ELISA | MO36905FYA | 100 µg | ||
| MO-AB-09229W | Monoclonal | Cat (Felis catus) | WB, ELISA | MO09229W | 100 µg | ||
| MO-AB-29235W | Monoclonal | Dog (Canis lupus familiaris) | WB, ELISA | MO29235W | 100 µg | ||
| MO-AB-41313W | Monoclonal | Guinea pig (Cavia porcellus) | WB, ELISA | MO41313W | 100 µg | ||
| MO-AB-42961W | Monoclonal | Hamsters (Cricetinae) | WB, ELISA | MO42961W | 100 µg | ||
| MO-AB-43848W | Monoclonal | Horse (Equus caballus) | WB, ELISA | MO43848W | 100 µg | ||
| MO-AB-08051R | Monoclonal | Cattle (Bos taurus) | WB, ELISA | MO08051R | 100 µg | ||
| MO-AB-24117R | Monoclonal | Pig (Sus scrofa) | WB, ELISA | MO24117R | 100 µg | ||
| MO-AB-01834H | Monoclonal | Frog (Xenopus laevis) | WB, ELISA | MO01834C | 100 µg | ||
| MO-AB-22996H | Monoclonal | Mallard (Anas platyrhynchos) | WB, ELISA | MO22996C | 100 µg | ||
| MO-AB-00158L | Monoclonal | Elephant (Loxodonta africana) | WB, ELISA | MO00158L | 100 µg | ||
| MO-AB-06335Y | Monoclonal | O. anatinus (Ornithorhynchus anatinus) | WB, ELISA | MO06335Y | 100 µg | ||
| MO-AB-10732Y | Monoclonal | O. mykiss (Oncorhynchus mykiss) | WB, ELISA | MO10732Y | 100 µg | ||
| MO-DKB-00681W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Primat, Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus) | WB, IF, IHC, IHC-P | 100 µg | |||
| MO-DKB-03273W | Polyclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, IF, IHC, IHC-P | 100 µg | |||
| MO-DKB-03604W | Monoclonal | Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) | WB, FC, IHC-P, IHC | ms2109-012 | 100 µg | ||
| MOFY-0622-FY3 | Monoclonal | Guinea pig | WB, IHC, ICC, IP | 100 µg | |||
| MOFY-0722-FY210 | Polyclonal | Dog, Human, Mouse, Rat | WB, IHC, ICC, IP | 100 µg |
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Zebrafish (Danio rerio), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Dog, Human, Mouse, Rat, Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Primat, Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Mallard (Anas platyrhynchos), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss) |
| Clone | MO67619FYA |
| Specificity | This antibody binds to Zebrafish bdnf. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Extracellular region or secreted |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | This gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer's, Parkinson's, and Huntington's disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. |
| Product Overview | Mouse Anti-Zebrafish bdnf Antibody is a mouse antibody against bdnf. It can be used for bdnf detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Brain-derived neurotrophic factor; bdn |
| UniProt ID | Q9YH42 |
| Protein Refseq | The length of the protein is 270 amino acids long. The sequence is show below: MTILFVTMVISYFSCMRAAPMREIPGVQGGHRAEGYLGAAAAAAAAVTSGSRGHGTPQSGGGLPSLTDTFEQVIEELLEVEGEATQQLGPGADQGQGGGGPIDAADSKDVDLYASRVMISNQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARWGELSVCDSISQWVTAVDKKTAIDMSGQTVTVLEKVPVTNGQLKQYFYETKCNPLGYTKEGCRGIDKRHYNSQCRTTQSYVRALTMDSKRKIGWRFIRIDTSCVCTLTIKRGR. |
See other products for " Bdnf "
| MO-AB-24357H | Mouse Anti-Bdnf Antibody (MO-AB-24357H) |
| MO-NAB-00428W | Rabbit Anti-BDNF Antibody (C-terminal) |
| MO-AB-00290Y | Mouse Anti-BDNF Antibody (MO-AB-00290Y) |
| MOFY-0622-FY209 | Rabbit Anti-BDNF Antibody (MOFY-0622-FY209) |
| MOFY-0622-FY118 | Rabbit Anti-BDNF Antibody (MOFY-0622-FY118) |
For Research Use Only | Not For Clinical Use.
Online Inquiry