Mouse Anti-BDNF Antibody (MO-AB-00290Y)


Cat: MO-AB-00290Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-00290Y Monoclonal Chicken (Gallus gallus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Dog, Human, Mouse, Rat, Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Primat, Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio), Mallard (Anas platyrhynchos), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss) WB, ELISA MO00290Y 100 µg
CBMOAB-00274FYA Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, IHC, IF F00274FYA 100 µg
CBMOAB-36905FYA Monoclonal Rhesus (Macaca mulatta) WB, ELISA MO36905FYA 100 µg
MO-AB-09229W Monoclonal Cat (Felis catus) WB, ELISA MO09229W 100 µg
MO-AB-29235W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29235W 100 µg
MO-AB-41313W Monoclonal Guinea pig (Cavia porcellus) WB, ELISA MO41313W 100 µg
MO-AB-42961W Monoclonal Hamsters (Cricetinae) WB, ELISA MO42961W 100 µg
MO-AB-43848W Monoclonal Horse (Equus caballus) WB, ELISA MO43848W 100 µg
MO-AB-08051R Monoclonal Cattle (Bos taurus) WB, ELISA MO08051R 100 µg
MO-AB-24117R Monoclonal Pig (Sus scrofa) WB, ELISA MO24117R 100 µg
MO-AB-01834H Monoclonal Frog (Xenopus laevis) WB, ELISA MO01834C 100 µg
MO-AB-22996H Monoclonal Mallard (Anas platyrhynchos) WB, ELISA MO22996C 100 µg
MO-AB-00158L Monoclonal Elephant (Loxodonta africana) WB, ELISA MO00158L 100 µg
MO-AB-06335Y Monoclonal O. anatinus (Ornithorhynchus anatinus) WB, ELISA MO06335Y 100 µg
MO-AB-10732Y Monoclonal O. mykiss (Oncorhynchus mykiss) WB, ELISA MO10732Y 100 µg
MO-DKB-00681W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Primat, Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Pig (Sus scrofa), Dog (Canis lupus familiaris), Horse (Equus caballus), Rabbit (Oryctolagus cuniculus) WB, IF, IHC, IHC-P 100 µg
MO-DKB-03273W Polyclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, IF, IHC, IHC-P 100 µg
MO-DKB-03604W Monoclonal Human (Homo sapiens), Mouse (Mus musculus), Rat (Rattus norvegicus), Zebrafish (Danio rerio) WB, FC, IHC-P, IHC ms2109-012 100 µg
MOFY-0622-FY3 Monoclonal Guinea pig WB, IHC, ICC, IP 100 µg
MOFY-0722-FY210 Polyclonal Dog, Human, Mouse, Rat WB, IHC, ICC, IP 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChicken (Gallus gallus), Cat (Felis catus), Cattle (Bos taurus), Dog (Canis lupus familiaris), Dog, Human, Mouse, Rat, Elephant (Loxodonta africana), Frog (Xenopus laevis), Guinea pig, Guinea pig (Cavia porcellus), Hamsters (Cricetinae), Horse (Equus caballus), Human (Homo sapiens), Mouse (Mus musculus), Primat, Rhesus (Macaca mulatta), Rat (Rattus norvegicus), Pig (Sus scrofa), Rabbit (Oryctolagus cuniculus), Zebrafish (Danio rerio), Mallard (Anas platyrhynchos), O. anatinus (Ornithorhynchus anatinus), O. mykiss (Oncorhynchus mykiss)
CloneMO00290Y
SpecificityThis antibody binds to Chicken BDNF.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationExtracellular region or secreted; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the nerve growth factor family of proteins. Alternative splicing results in multiple transcript variants, at least one of which encodes a preproprotein that is proteolytically processed to generate the mature protein. Binding of this protein to its cognate receptor promotes neuronal survival in the adult brain. Expression of this gene is reduced in Alzheimer''s, Parkinson''s, and Huntington''s disease patients. This gene may play a role in the regulation of the stress response and in the biology of mood disorders. During development, promotes the survival and differentiation of selected neuronal populations of the peripheral and central nervous systems. Participates in axonal growth, pathfinding and in the modulation of dendritic growth and morphology. Major regulator of synaptic transmission and plasticity at adult synapses in many regions of the CNS. (From NCBI)
Product OverviewThis product is a mouse antibody against BDNF. It can be used for BDNF detection in Western Blot and Enzyme-Linked Immunosorbent Assay.
Alternative NamesBrain-derived neurotrophic factor transcript variant 3; BDNF
UniProt IDK4MQC6
Protein RefseqThe length of the protein is 246 amino acids long. The sequence is show below: MTILFLTMVISYFSRMKAAPMKEASVRGHGSLAYPGLRTHGTLESLTGPNAGSRGLTSLADTFEHVIEELLDEDQDIQPSEENKDADLYTSRVMLSSQVPLEPPLLFLLEEYKNYLDAANMSMRVRRHSDPARRGELSVCDSTSEWVTAAEKKTAVDMSGATVTVLEKVPVPKGQLKQYFYETKCNPKGYTKEGCRGIDKRHWNSQCRTTQSYVRALTMDNKKRVGWRFIRIDTSCVCTLTIKRGR.
For Research Use Only | Not For Clinical Use.
Online Inquiry