Mouse Anti-Cat MOCS3 Antibody (MO-AB-08088W)


Cat: MO-AB-08088W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCat (Felis catus)
CloneMO08088W
SpecificityThis antibody binds to Cat MOCS3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationCytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionMolybdenum cofactor (MoCo) is necessary for the function of all molybdoenzymes. The protein encoded by this gene adenylates and activates molybdopterin synthase, an enzyme required for biosynthesis of MoCo. This gene contains no introns. A pseudogene of this gene is present on chromosome 14.
Product OverviewMouse Anti-Cat MOCS3 Antibody is a mouse antibody against MOCS3. It can be used for MOCS3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesAdenylyltransferase and sulfurtransferase MOCS3; Molybdenum cofactor synthesis protein 3; MOCS3; UBA4
UniProt IDM3X4P1
Protein RefseqThe length of the protein is 458 amino acids long.
The sequence is show below: MASREEVLALQAQVAQREEELSFLKQKLAAAILAEQEPERLVSVSPLPPKASLSRDEILRYSRQLVLPELGVQGQLRLAAASVLVVGCGGLGCPLAQYLAAAGVGRLGLVDYDVVEMSNLARQVLHGEALAGQAKVFSAAASLRRLNSAVECVPYAEALTPATALDLVRRYDVVADCSDNVPTRYLVNDACVLARRPLVSASALRFEGQITVYHYDGGPCYRCVFPQPPPAETVTNCADGGVLGVVTGVLGCLQALEVLKIAAGLGPSYSGSLLIFDALRGHFRCIQLRGRRPDCAACGERPTVTALQDYEAFCGSSATDKCRSLRLLSPEERVSVTDYKRLLDSGSPHLLLDVRPQVEVDICRLPHALHIPLKRLERRDAESLELLGEAIREGKQGTQEGAAFPVYVICKLGNDSQKAVKILQSLTAVQELESYTVQDVVGGLMAWAAKVDGTFPQY.
See other products for " MOCS3 "
MO-AB-31815WMouse Anti-Dog MOCS3 Antibody (MO-AB-31815W)
MO-AB-00820LMouse Anti-Elephant MOCS3 Antibody (MO-AB-00820L)
MO-AB-15905RMouse Anti-Cattle MOCS3 Antibody (MO-AB-15905R)
CBMOAB-36631FYCMouse Anti-Arabidopsis MOCS3 Antibody (CBMOAB-36631FYC)
MO-AB-39252WMouse Anti-Grape MOCS3 Antibody (MO-AB-39252W)
CBMOAB-34680FYBMouse Anti-Rice MOCS3 Antibody (CBMOAB-34680FYB)
MO-AB-42094WMouse Anti-Guinea pig MOCS3 Antibody (MO-AB-42094W)
MO-AB-36309WMouse Anti-French-bean MOCS3 Antibody (MO-AB-36309W)
MO-AB-12101YMouse Anti-O. mykiss MOCS3 Antibody (MO-AB-12101Y)
MO-AB-13778WMouse Anti-Chimpanzee MOCS3 Antibody (MO-AB-13778W)
For Research Use Only | Not For Clinical Use.
Online Inquiry