Mouse Anti-Cattle CD19 Antibody (MO-AB-09782R)


Cat: MO-AB-09782R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09782R
SpecificityThis antibody binds to Cattle CD19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD19 (CD19 Molecule) is a Protein Coding gene. Diseases associated with CD19 include Immunodeficiency, Common Variable, 3 and Common Variable Immunodeficiency. Among its related pathways are RET signaling and Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers. Gene Ontology (GO) annotations related to this gene include signal transducer activity, downstream of receptor.
Product OverviewMouse Anti-Cattle CD19 Antibody is a mouse antibody against CD19. It can be used for CD19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD19; CD19
UniProt IDC9EGS9
Protein RefseqThe length of the protein is 568 amino acids long.
The sequence is show below: MPPPLLFLLLFLTPVGVRPEDPRLVEAKEGGDTVLPCLEGSSAGPPEQLAWFRGSQTTPFLNLSLGLPGLGIHVGPLGTLKEPQGTLLFLFNVSKHMGGFYLCQPGLSSEQGWQPSWTVSVQGSGKLFRWNASDLNDPSCDLRNKTSKGPRSSSGHPTKSQLNVWGTDHFKEISHADLPCAPPNSTLNHSDNRDLTVAPGSTLLLSCGASHTSLVRGSVSWIHKYPMKPEVKLLSLYVSEHAQLREMWVMGTLGG.

Reference

Reference1. Zhao, H., Tang, X., Wu, M., Li, Q., Yi, X., Liu, S., ... & Sun, X. (2021). Transcriptome characterization of short distance transport stress in beef cattle blood. Frontiers in Genetics, 12, 616388.
2. Pringle, E. S., Firth, M. A., Chattha, K. S., Hodgins, D. C., & Shewen, P. E. (2012). Expression of complement receptors 1 (CR1/CD35) and 2 (CR2/CD21), and co-signaling molecule CD19 in cattle. Developmental & Comparative Immunology, 38(4), 487-494.
3. Sopp, P., Kwong, L. S., & Howard, C. J. (2001). Cross-reactivity with bovine cells of monoclonal antibodies submitted to the 6th International Workshop on Human Leukocyte Differentiation Antigens. Veterinary immunology and immunopathology, 78(2), 197-206.
For Research Use Only | Not For Clinical Use.
Online Inquiry