Mouse Anti-Marmoset CD19 Antibody (MO-AB-52537W)


Cat: MO-AB-52537W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityMarmoset
CloneMO52537W
SpecificityThis antibody binds to Marmoset CD19.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD19 (CD19 Molecule) is a Protein Coding gene. Diseases associated with CD19 include Immunodeficiency, Common Variable, 3 and Common Variable Immunodeficiency. Among its related pathways are RET signaling and Hematopoietic Stem Cell Differentiation Pathways and Lineage-specific Markers. Gene Ontology (GO) annotations related to this gene include signal transducer activity, downstream of receptor.
Product OverviewMouse Anti-Marmoset CD19 Antibody is a mouse antibody against CD19. It can be used for CD19 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesB-lymphocyte antigen CD19; CD19
UniProt IDF7IB86
Protein RefseqThe length of the protein is 406 amino acids long.
The sequence is show below: MSSQLYVWAKDRPKIWEGEPPCGLLRDSLNQTLSQDLTMAPGSTLWLSCGVPPDSVSRGPLSWTHVRPKETNFSLLSLELKDNRPARDMWVMEKGLLLPQATAQDAGKYYCHRGNLTISWHLEITARSALWHWLVRTGGWKVLAVTLTYMIFCLGSLVGILHLQRALVLRRKRKRMTDPTRRFFKVTPPPGSGPQNQYGNVLSLPTPTSGLGRAQRWAAGLGGTAPSYRNPRSDVEADGTVGSRSPPGAGPEEEEGEGYEEPDSEEGSEFYENDSSLGQDQLSQDGSGYENPEDEPLGPEDEDSFSNAESYENEDEELTQPVSRTMDFLSPHGSAWDPSREATSLGSQSYEDMRGILYSAPQLRSIRGQPGPNHEEDADSYENMDNPDRPDPPWGGGGHVGTWGAR.

Reference

ReferenceKap, Y. S., van Driel, N., Blezer, E., Parren, P. W., Bleeker, W. K., Laman, J. D., ... & t Hart, B. A. (2010). Late B cell depletion with a human anti-human CD20 IgG1κ monoclonal antibody halts the development of experimental autoimmune encephalomyelitis in marmosets. The Journal of Immunology, 185(7), 3990-4003.
See other products for " CD19 "
MO-AB-09782RMouse Anti-Cattle CD19 Antibody (MO-AB-09782R)
MO-AB-43981WMouse Anti-Horse CD19 Antibody (MO-AB-43981W)
MO-AB-41362WMouse Anti-Guinea pig CD19 Antibody (MO-AB-41362W)
CBMOAB-38636FYAMouse Anti-Rhesus CD19 Antibody (CBMOAB-38636FYA)
MO-AB-24613HMouse Anti-Rat Cd19 Antibody (MO-AB-24613H)
For Research Use Only | Not For Clinical Use.
Online Inquiry