Mouse Anti-Cattle CD247 Antibody (MO-AB-09801R)


Cat: MO-AB-09801R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO09801R
SpecificityThis antibody binds to Cattle CD247.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionPart of the TCR-CD3 complex present on T-lymphocyte cell surface that plays an essential role in adaptive immune response. When antigen presenting cells (APCs) activate T-cell receptor (TCR), TCR-mediated signals are transmitted across the cell membrane by the CD3 chains CD3D, CD3E, CD3G and CD3Z. All CD3 chains contain immunoreceptor tyrosine-based activation motifs (ITAMs) in their cytoplasmic domain. Upon TCR engagement, these motifs become phosphorylated by Src family protein tyrosine kinases LCK and FYN, resulting in the activation of downstream signaling pathways. CD3Z ITAMs phosphorylation creates multiple docking sites for the protein kinase ZAP70 leading to ZAP70 phosphorylation and its conversion into a catalytically active enzyme. Plays an important role in intrathymic T-cell differentiation. Additionally, participates in the activity-dependent synapse formation of retinal ganglion cells (RGCs) in both the retina and dorsal lateral geniculate nucleus (dLGN).
Product OverviewMouse Anti-Cattle CD247 Antibody is a mouse antibody against CD247. It can be used for CD247 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCD247 molecule; CD247
UniProt IDQ0VCU4
Protein RefseqThe length of the protein is 166 amino acids long.
The sequence is show below: MKWTALVIVAILQAQFPITAAQSFGLLDPKLCYLLDGILFIYGVIVTALFLRAKFSRSANAPAYQQGQNPVYNELNVGRREEYAVLDRRGGFDPEKGGKPQRKKNPNEVVYNELRKDKMAEAYSEIGMKSDNQRRRGKGHDGLYQGLSTATKDTYDALHMQALPPR.
For Research Use Only | Not For Clinical Use.
Online Inquiry