Mouse Anti-Rhesus CD247 Antibody (MO-AB-01557W)


Cat: MO-AB-01557W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRhesus (Macaca mulatta)
CloneMO01557W
SpecificityThis antibody binds to Rhesus CD247.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD247 (CD247 Molecule) is a Protein Coding gene. Diseases associated with CD247 include Immunodeficiency 25 and T-B+ Severe Combined Immunodeficiency Due To Cd3delta / Cd3epsilon / Cd3zeta. Among its related pathways are G-protein signaling N-RAS regulation pathway and Role of phospholipids in phagocytosis. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and transmembrane signaling receptor activity.
Product OverviewMouse Anti-Rhesus CD247 Antibody is a mouse antibody against CD247. It can be used for CD247 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesT-cell surface glycoprotein CD3 zeta chain isoform 2; CD247
UniProt IDH9ZF95
Protein RefseqThe length of the protein is 165 amino acids long.
The sequence is show below: MKWKELVTAAILQAQFPITEAQSFGLLDPKLCYLLDGILFLYGVILTALFLRAKFSRSADAPAYQQGQNQLYNELNLGRREEYDVLDKRRGRDPEMGGKPRRKNPQEGLYNALQKDKMAEAYSEIGMKGENQRRRGKGHDGLYQGLSTATKDTYDALHMQTLPPR.
For Research Use Only | Not For Clinical Use.
Online Inquiry