Mouse Anti-Ferret CD247 Antibody (MO-AB-34515W)
Cat: MO-AB-34515W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Ferret (Mustela Putorius Furo) |
Clone | MO34515W |
Specificity | This antibody binds to Ferret CD247. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | CD247 (CD247 Molecule) is a Protein Coding gene. Diseases associated with CD247 include Immunodeficiency 25 and T-B+ Severe Combined Immunodeficiency Due To Cd3delta/Cd3epsilon/Cd3zeta. Among its related pathways are G-protein signaling N-RAS regulation pathway and Role of phospholipids in phagocytosis. Gene Ontology (GO) annotations related to this gene include protein homodimerization activity and transmembrane signaling receptor activity. |
Product Overview | Mouse Anti-Ferret CD247 Antibody is a mouse antibody against CD247. It can be used for CD247 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | CD247 antigen; CD247 |
UniProt ID | D7F073 |
Protein Refseq | The length of the protein is 50 amino acids long. The sequence is show below: GNVTMECKFPVEKQLNLLALIVYWEMEDKKIIQFVDGKEDLQVQHSSYSQ. |
See other products for " cd247 "
MO-AB-02199H | Mouse Anti-Frog cd247 Antibody (MO-AB-02199H) |
MO-AB-09801R | Mouse Anti-Cattle CD247 Antibody (MO-AB-09801R) |
MO-AB-01557W | Mouse Anti-Rhesus CD247 Antibody (MO-AB-01557W) |
MO-AB-24621H | Mouse Anti-Rat Cd247 Antibody (MO-AB-24621H) |
MO-AB-07520Y | Mouse Anti-Rabbit CD247 Antibody (MO-AB-07520Y) |
CBMOAB-38678FYA | Mouse Anti-Rhesus CD247 Antibody (CBMOAB-38678FYA) |
CBMOAB-69668FYA | Mouse Anti-Zebrafish cd247 Antibody (CBMOAB-69668FYA) |
MO-AB-14493Y | Mouse Anti-Sheep CD247 Antibody (MO-AB-14493Y) |
For Research Use Only | Not For Clinical Use.
Online Inquiry