Mouse Anti-Cattle grp78 Antibody (MO-AB-13372R)
Cat: MO-AB-13372R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Cattle (Bos taurus) |
Clone | MO13372R |
Specificity | This antibody binds to Cattle grp78. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | GRP78 is a ubiquitously expressed 78kDa glucose-regulated protein commonly referred to as an immunoglobulin chain-binding protein (BiP). BiP is classified as a stress-responsive protein and plays an important role in the folding and assembly of nascent proteins and the clearance of misfolded proteins in the lumen of the endoplasmic reticulum. Translation of BiP is directed by an internal ribosome entry site (IRES) in the 5-untranslated region of BiP mRNA. BIP IRES activity increases when cells are heat stressed. GRP78 is also important in maintaining cellular homeostasis and preventing apoptosis. Decreased levels of GRP78 protein in the brains of Alzheimer''s disease patients. |
Product Overview | Mouse Anti-Cattle grp78 Antibody is a mouse antibody against grp78. It can be used for grp78 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Heat shock 70kDa protein 5, Fragment; grp78 |
UniProt ID | Q6KDN8 |
Protein Refseq | The length of the protein is 42 amino acids long. The sequence is show below: RPLTKDNHLLGTFDLTGIPPAPRGVPQIEVTFEIDVNGILRV. |
See other products for " GRP78 "
MO-AB-11547Y | Mouse Anti-O. mykiss GRP78 Antibody (MO-AB-11547Y) |
MOFAB-106W | Mouse Anti-GRP78 Antibody (MOFAB-106W) |
MO-AB-69914W | Mouse Anti-Silkworm grp78 Antibody (MO-AB-69914W) |
MO-AB-44946W | Mouse Anti-Horse GRP78 Antibody (MO-AB-44946W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry