Mouse Anti-Horse GRP78 Antibody (MO-AB-44946W)


Cat: MO-AB-44946W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHorse (Equus caballus)
CloneMO44946W
SpecificityThis antibody binds to Horse GRP78.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionGRP78 is a ubiquitously expressed 78kDa glucose-regulated protein commonly referred to as an immunoglobulin chain-binding protein (BiP). BiP is classified as a stress-responsive protein and plays an important role in the folding and assembly of nascent proteins and the clearance of misfolded proteins in the lumen of the endoplasmic reticulum. Translation of BiP is directed by an internal ribosome entry site (IRES) in the 5-untranslated region of BiP mRNA. BIP IRES activity increases when cells are heat stressed. GRP78 is also important in maintaining cellular homeostasis and preventing apoptosis. Decreased levels of GRP78 protein in the brains of Alzheimer''s disease patients.
Product OverviewMouse Anti-Horse GRP78 Antibody is a mouse antibody against GRP78. It can be used for GRP78 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative Names78 kDa glucose-regulated protein; GRP78
UniProt IDQ9N1V8
Protein RefseqThe length of the protein is99 amino acids long.
The sequence is show below: NDQGNRITPSYVAFTPEGERLIGDAAKNQLTSNPENTVFDAKRLIGRTWNDPSVQQDIKFLPFKVVEKKTKPYVQVDIGGGQTKTFAPEEISAMVLTKM.
For Research Use Only | Not For Clinical Use.
Online Inquiry