Mouse Anti-Cattle MED9 Antibody (MO-AB-15535R)


Cat: MO-AB-15535R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO15535R
SpecificityThis antibody binds to Cattle MED9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionComponent of the Mediator complex, a coactivator involved in the regulated transcription of nearly all RNA polymerase II-dependent genes. Mediator functions as a bridge to convey information from gene-specific regulatory proteins to the basal RNA polymerase II transcription machinery. Mediator is recruited to promoters by direct interactions with regulatory proteins and serves as a scaffold for the assembly of a functional preinitiation complex with RNA polymerase II and the general transcription factors.
Product OverviewMouse Anti-Cattle MED9 Antibody is a mouse antibody against MED9. It can be used for MED9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator of RNA polymerase II transcription subunit 9; Mediator complex subunit 9; MED9; MED25
UniProt IDQ2KHX9
Protein RefseqThe length of the protein is 145 amino acids long.
The sequence is show below: MASVGVAAGRQAEDTLPPPAEPPLPEMKPLPQPQPPPSVSAQQPQPAPKPPSPAGVKAEENCSFLPLVHSIIKCMDKDSPDIHQDLNTLKAKFQEMRKVVSTMPGIHLSPEQQQQQLQRLREQVRTKNELLQKYKSLCMFEIPKE.
For Research Use Only | Not For Clinical Use.
Online Inquiry