Mouse Anti-D. melanogaster Med9 Antibody (CBMOAB-23597FYA)


Cat: CBMOAB-23597FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFruit fly (Drosophila melanogaster)
CloneMO23597FYA
SpecificityThis antibody binds to fruit fly Med9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
Product OverviewMouse Anti-D. melanogaster Med9 Antibody is a mouse antibody against Med9. It can be used for Med9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator of RNA polymerase II transcription subunit 9; Mediator complex subunit 9; MED9
UniProt IDA1ZB42
Protein RefseqThe length of the protein is 144 amino acids long.
The sequence is show below: MMDLSPNNQIEDRKPILTADGLVQTSNSPFEPTISQETQTSNGIGGQCHLTVDQLDIEILPIIYDIVRCVEKDPLENAVKLRESQDCNHKIFELQKRFESAREQIRQLPGIDFNKEEQQQRLELLRNQLKLKQQLIRKYKDTEF.
For Research Use Only | Not For Clinical Use.
Online Inquiry