Mouse Anti-Mallard MED9 Antibody (MO-AB-23432H)
Cat: MO-AB-23432H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Mallard (Anas platyrhynchos) |
Clone | MO23432C |
Specificity | This antibody binds to Mallard MED9. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17. |
Product Overview | This product is a mouse antibody against MED9. It can be used for MED9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Mediator of RNA polymerase II transcription subunit 9; MED8 |
UniProt ID | R0KC06 |
Protein Refseq | The length of the protein is 71 amino acids long. The sequence is show below: MDKDSQDVHQVLNELKNKFQEMRKLISSMPGISVSPEQQQQQLQSLREQVRTKNELLQKYKSLCMFEIPKE. |
See other products for " MED9 "
MO-AB-06096Y | Mouse Anti-A. aegpti MED9 Antibody (MO-AB-06096Y) |
MO-AB-13486W | Mouse Anti-Chimpanzee MED9 Antibody (MO-AB-13486W) |
MO-AB-12062Y | Mouse Anti-O. mykiss MED9 Antibody (MO-AB-12062Y) |
MO-AB-27045H | Mouse Anti-Rat Med9 Antibody (MO-AB-27045H) |
MO-AB-43268W | Mouse Anti-Hamsters MED9 Antibody (MO-AB-43268W) |
CBMOAB-23597FYA | Mouse Anti-D. melanogaster Med9 Antibody (CBMOAB-23597FYA) |
MO-AB-15535R | Mouse Anti-Cattle MED9 Antibody (MO-AB-15535R) |
MO-AB-35117W | Mouse Anti-Ferret MED9 Antibody (MO-AB-35117W) |
MO-AB-58953W | Mouse Anti-Marmoset MED9 Antibody (MO-AB-58953W) |
CBMOAB-36379FYC | Mouse Anti-Arabidopsis MED9 Antibody (CBMOAB-36379FYC) |
For Research Use Only | Not For Clinical Use.
Online Inquiry