Mouse Anti-Hamsters MED9 Antibody (MO-AB-43268W)


Cat: MO-AB-43268W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityHamsters (Cricetinae)
CloneMO43268W
SpecificityThis antibody binds to Hamsters MED9.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe multiprotein Mediator complex is a coactivator required for activation of RNA polymerase II transcription by DNA bound transcription factors. The protein encoded by this gene is thought to be a subunit of the Mediator complex. This gene is located within the Smith-Magenis syndrome region on chromosome 17.
Product OverviewMouse Anti-Hamsters MED9 Antibody is a mouse antibody against MED9. It can be used for MED9 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMediator of RNA polymerase II transcription subunit 9; MED9
UniProt IDG3HHP5
Protein RefseqThe length of the protein is71 amino acids long.
The sequence is show below: MDKDSPDLHQDLNALKTKFQEMRKLIGTMPGIHMSPEQQQQQLHSLREQVRTKNELLQKYKSLCMFEIPKE.
See other products for " Med9 "
MO-AB-27045HMouse Anti-Rat Med9 Antibody (MO-AB-27045H)
MO-AB-58953WMouse Anti-Marmoset MED9 Antibody (MO-AB-58953W)
CBMOAB-36379FYCMouse Anti-Arabidopsis MED9 Antibody (CBMOAB-36379FYC)
MO-AB-23432HMouse Anti-Mallard MED9 Antibody (MO-AB-23432H)
MO-AB-12062YMouse Anti-O. mykiss MED9 Antibody (MO-AB-12062Y)
MO-AB-15535RMouse Anti-Cattle MED9 Antibody (MO-AB-15535R)
MO-AB-06096YMouse Anti-A. aegpti MED9 Antibody (MO-AB-06096Y)
CBMOAB-23597FYAMouse Anti-D. melanogaster Med9 Antibody (CBMOAB-23597FYA)
MO-AB-35117WMouse Anti-Ferret MED9 Antibody (MO-AB-35117W)
MO-AB-13486WMouse Anti-Chimpanzee MED9 Antibody (MO-AB-13486W)
For Research Use Only | Not For Clinical Use.
Online Inquiry