Mouse Anti-Cattle UBB Antibody (MO-AB-22484R)
Cat: MO-AB-22484R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO22484R |
| Specificity | This antibody binds to Cattle UBB. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Mitochondrion; Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Ubiquitin is a highly conserved 76 amino acid protein with an estimated molecular weight of 8.56 kDa, which plays a central role in regulating protein degradation. It is a protein modifier that can be covalently linked to the target lysine as a monomer or as a lysine-linked polymer. Depending on the lysine used for assembly, several types of polymer chains can be formed. Attaching to proteins as polymers will cause them to be degraded by 26S proteosome; a complex multi-catalytic cytosolic and nuclear protease. Polymers attached as monomers or as alternatives to proteins will not cause proteasome degradation and may be required for many functions, including maintenance of color structure, gene expression regulation, stress response, ribosome biogenesis, and DNA repair. Ubiquitin is synthesized as a polyubiquitin precursor with precise head-to-tail repeats, and the number of repeats varies with species and strains. In some species, there is a final amino acid after the last repetition, which is cysteine in cattle. Some ubiquitin genes contain a single copy of ubiquitin fused to ribosomal protein (L40 or S27a). |
| Product Overview | This product is a mouse antibody against UBB. It can be used for UBB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Polyubiquitin-B; [Cleaved into: Ubiquitin]; UBB |
| UniProt ID | P0CG53 |
| Protein Refseq | The length of the protein is 305 amino acids long. The sequence is show below: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVK. |
See other products for " ubb "
| CBMOAB-11457FYB | Mouse Anti-Zebrafish ubb Antibody (CBMOAB-11457FYB) |
| MO-MMB-0546 | Anti-UBB Antibody (Cat MO-MMB-0546), Mouse IgG1 |
| MO-AB-42785W | Mouse Anti-Guinea pig UBB Antibody (MO-AB-42785W) |
| MO-AB-31075R | Mouse Anti-Pig UBB Antibody (MO-AB-31075R) |
| MO-AB-46975W | Mouse Anti-Horse UBB Antibody (MO-AB-46975W) |
| MO-AB-08869H | Mouse Anti-Frog ubb Antibody (MO-AB-08869H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry