Mouse Anti-Pig UBB Antibody (MO-AB-31075R)


Cat: MO-AB-31075R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityPig (Sus scrofa)
CloneMO31075R
SpecificityThis antibody binds to Pig UBB.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus; Other locations; Mitochondrion

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionUbiquitin is a highly conserved 76 amino acid protein with an estimated molecular weight of 8.56 kDa, which plays a central role in regulating protein degradation. It is a protein modifier that can be covalently linked to the target lysine as a monomer or as a lysine-linked polymer. Depending on the lysine used for assembly, several types of polymer chains can be formed. Attaching to proteins as polymers will cause them to be degraded by 26S proteosome; a complex multi-catalytic cytosolic and nuclear protease. Polymers attached as monomers or as alternatives to proteins will not cause proteasome degradation and may be required for many functions, including maintenance of color structure, gene expression regulation, stress response, ribosome biogenesis, and DNA repair. Ubiquitin is synthesized as a polyubiquitin precursor with precise head-to-tail repeats, and the number of repeats varies with species and strains. In some species, there is a final amino acid after the last repetition, which is cysteine ​​in cattle. Some ubiquitin genes contain a single copy of ubiquitin fused to ribosomal protein (L40 or S27a).
Product OverviewThis product is a mouse antibody against UBB. It can be used for UBB detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUbiquitin B; UBB
UniProt IDA7U5U2
Protein RefseqThe length of the protein is 229 amino acids long.
The sequence is show below: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC.
For Research Use Only | Not For Clinical Use.
Online Inquiry