Mouse Anti-Horse UBB Antibody (MO-AB-46975W)
Cat: MO-AB-46975W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO46975W |
Specificity | This antibody binds to Horse UBB. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes ubiquitin, one of the most conserved proteins known. Ubiquitin has a major role in targeting cellular proteins for degradation by the 26S proteosome. It is also involved in the maintenance of chromatin structure, the regulation of gene expression, and the stress response. Ubiquitin is synthesized as a precursor protein consisting of either polyubiquitin chains or a single ubiquitin moiety fused to an unrelated protein. This gene consists of three direct repeats of the ubiquitin coding sequence with no spacer sequence. Consequently, the protein is expressed as a polyubiquitin precursor with a final amino acid after the last repeat. An aberrant form of this protein has been detected in patients with Alzheimer's disease and Down syndrome. Pseudogenes of this gene are located on chromosomes 1, 2, 13, and 17. Alternative splicing results in multiple transcript variants. |
Product Overview | Mouse Anti-Horse UBB Antibody is a mouse antibody against UBB. It can be used for UBB detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Polyubiquitin-B; [Cleaved into: Ubiquitin; Ubiquitin-related]; UBB |
UniProt ID | Q8MKD1 |
Protein Refseq | The length of the protein is305 amino acids long. The sequence is show below: MQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRFIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGMQIFVKTLTGKTITLEVEPSDTIENVKAKIQDKEGIPPDQQRLIFAGKQLEDGRTLSDYNIQKESTLHLVLRLRGGC. |
See other products for " ubb "
MO-AB-08869H | Mouse Anti-Frog ubb Antibody (MO-AB-08869H) |
MO-AB-31075R | Mouse Anti-Pig UBB Antibody (MO-AB-31075R) |
MO-AB-42785W | Mouse Anti-Guinea pig UBB Antibody (MO-AB-42785W) |
CBMOAB-11457FYB | Mouse Anti-Zebrafish ubb Antibody (CBMOAB-11457FYB) |
MO-MMB-0546 | Anti-UBB Antibody (Cat MO-MMB-0546), Mouse IgG1 |
MO-AB-22484R | Mouse Anti-Cattle UBB Antibody (MO-AB-22484R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry