Mouse Anti-Cattle UMOD Antibody (MO-AB-22598R)


Cat: MO-AB-22598R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityCattle (Bos taurus)
CloneMO22598R
SpecificityThis antibody binds to Cattle UMOD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Extracellular region or secreted; Cytoskeleton; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is the most abundant protein in mammalian urine under physiological conditions. Its excretion in urine follows proteolytic cleavage of the ectodomain of its glycosyl phosphatidylinosital-anchored counterpart that is situated on the luminal cell surface of the loop of Henle. This protein may act as a constitutive inhibitor of calcium crystallization in renal fluids. Excretion of this protein in urine may provide defense against urinary tract infections caused by uropathogenic bacteria. Defects in this gene are associated with the renal disorders medullary cystic kidney disease-2 (MCKD2), glomerulocystic kidney disease with hyperuricemia and isosthenuria (GCKDHI), and familial juvenile hyperuricemic nephropathy (FJHN). Alternative splicing of this gene results in multiple transcript variants. [provided by RefSeq, Jul 2013]
Product OverviewThis product is a mouse antibody against UMOD. It can be used for UMOD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesUromodulin; Tamm-Horsfall urinary glycoprotein; THP; [Cleaved into: Uromodulin, secreted form]; UMOD
UniProt IDP48733
Protein RefseqThe length of the protein is 643 amino acids long.
The sequence is show below: MKCLFSPNFMWMAAVVTSWVIIPAATDTSSAKSCSECHSNATCTVDGAATTCACQEGFTGDGLECVDLDECAVLGAHNCSATKSCVNTLGSYTCVCPEGFLLSSELGCEDVDECAEPGLSRCHALATCINGEGNYSCVCPAGYLGDGRHCECSPGSCGPGLDCVREGDALVCVDPCQVHRILDEYWRSTEYGSGYICDVSLGGWYRFVGQAGVRLPETCVPVLHCNTAAPMWLNGTHPSSDEGIVNRVACAHWSG.
For Research Use Only | Not For Clinical Use.
Online Inquiry