Mouse Anti-Chimpanzee FADD Antibody (MO-AB-15105W)


Cat: MO-AB-15105W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO15105W
SpecificityThis antibody binds to Chimpanzee FADD.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma membrane; Cytosol; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThe protein encoded by this gene is an adaptor molecule that interacts with various cell surface receptors and mediates cell apoptotic signals. Through its C-terminal death domain, this protein can be recruited by TNFRSF6/Fas-receptor, tumor necrosis factor receptor, TNFRSF25, and TNFSF10/TRAIL-receptor, and thus it participates in the death signaling initiated by these receptors. Interaction of this protein with the receptors unmasks the N-terminal effector domain of this protein, which allows it to recruit caspase-8, and thereby activate the cysteine protease cascade. Knockout studies in mice also suggest the importance of this protein in early T cell development.
Product OverviewMouse Anti-Chimpanzee FADD Antibody is a mouse antibody against FADD. It can be used for FADD detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFas (TNFRSF6)-associated via death domain; FADD
UniProt IDH2Q4B6
Protein RefseqThe length of the protein is 208 amino acids long.
The sequence is show below: MDPFLVLLHSVSSSLSSSELTELKFLCLGRVGKRKMERVQSGLDLFSMLLEQNDLEPGHTELLRELLASLRRHDLLRRVDDFEAGAAARAAPGEEDLCAAFNVICDNVGKDWRRLARQLKVSDTKIDSIEDRYPRNLTERVRESLRIWKNTEKENATVAHLVGALRACQMNLVADLVQEVQQARDLQNRSGAVSPMSWNSDASTSEAS.
For Research Use Only | Not For Clinical Use.
Online Inquiry