Mouse Anti-Chimpanzee NR3C1 Antibody (MO-AB-27131W)
Cat: MO-AB-27131W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Chimpanzee (Pan troglodytes) |
Clone | MO27131W |
Specificity | This antibody binds to Chimpanzee NR3C1. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes glucocorticoid receptor, which can function both as a transcription factor that binds to glucocorticoid response elements in the promoters of glucocorticoid responsive genes to activate their transcription, and as a regulator of other transcription factors. This receptor is typically found in the cytoplasm, but upon ligand binding, is transported into the nucleus. It is involved in inflammatory responses, cellular proliferation, and differentiation in target tissues. Mutations in this gene are associated with generalized glucocorticoid resistance. Alternative splicing of this gene results in transcript variants encoding either the same or different isoforms. Additional isoforms resulting from the use of alternate in-frame translation initiation sites have also been described, and shown to be functional, displaying diverse cytoplasm-to-nucleus trafficking patterns and distinct transcriptional activities (PMID:15866175). |
Product Overview | Mouse Anti-Chimpanzee NR3C1 Antibody is a mouse antibody against NR3C1. It can be used for NR3C1 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | NR3C1 |
UniProt ID | A2T735 |
Protein Refseq | The length of the protein is 50 amino acids long. The sequence is show below: VVENLLNYCFQTFLDKTMSIEFPEMLAEIITNQIPKYSNGNIKKLLFHQK. |
See other products for " NR3C1 "
MO-AB-15330W | Mouse Anti-Chimpanzee NR3C1 Antibody (MO-AB-15330W) |
MO-AB-16366Y | Mouse Anti-Sheep NR3C1 Antibody (MO-AB-16366Y) |
MO-NAB-00478W | Rabbit Anti-NR3C1 Antibody |
MO-AB-01075R | Mouse Anti-Medaka nr3c1 Antibody (MO-AB-01075R) |
CBMOAB-89903FYA | Mouse Anti-Zebrafish nr3c1 Antibody (CBMOAB-89903FYA) |
MO-AB-45811W | Mouse Anti-Horse NR3C1 Antibody (MO-AB-45811W) |
MO-AB-60301W | Mouse Anti-Marmoset NR3C1 Antibody (MO-AB-60301W) |
CBMOAB-00294FYA | Rabbit Anti-Mouse NR3C1 Antibody (CBMOAB-00294FYA) |
CBMOAB-52949FYA | Mouse Anti-Rhesus NR3C1 Antibody (CBMOAB-52949FYA) |
MO-AB-42172W | Mouse Anti-Guinea pig NR3C1 Antibody (MO-AB-42172W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry