Mouse Anti-Chimpanzee SUMO2 Antibody (MO-AB-18641W)


Cat: MO-AB-18641W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityChimpanzee (Pan troglodytes)
CloneMO18641W
SpecificityThis antibody binds to Chimpanzee SUMO2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionUbiquitin-like protein that can be covalently attached to proteins as a monomer or as a lysine-linked polymer. Covalent attachment via an isopeptide bond to its substrates requires prior activation by the E1 complex SAE1-SAE2 and linkage to the E2 enzyme UBE2I, and can be promoted by an E3 ligase such as PIAS1-4, RANBP2 or CBX4. This post-translational modification on lysine residues of proteins plays a crucial role in a number of cellular processes such as nuclear transport, DNA replication and repair, mitosis and signal transduction. Polymeric SUMO2 chains are also susceptible to polyubiquitination which functions as a signal for proteasomal degradation of modified proteins. Plays a role in the regulation of sumoylation status of SETX (By similarity).
Product OverviewMouse Anti-Chimpanzee SUMO2 Antibody is a mouse antibody against SUMO2. It can be used for SUMO2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesSMT3 suppressor of mif two 3 homolog 2; SUMO2
UniProt IDK7D890
Protein RefseqThe length of the protein is 139 amino acids long.
The sequence is show below: MHPLPSSTAAASFFCRSWCCLCARLVRTWYLFCEAAAEETPALAMADEKPKEGVKTENNDHINLKVAGQDGSVVQFKIKRHTPLSKLMKAYCERQGLSMRQIRFRFDGQPINETDTPAQLEMEDEDTIDVFQQQTGGVY.
For Research Use Only | Not For Clinical Use.
Online Inquiry