Mouse Anti-cyba Antibody (CBMOAB-72539FYA)


Cat: CBMOAB-72539FYA
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
CBMOAB-72539FYA Monoclonal Zebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris) WB, ELISA MO72539FYA 100 µg
MO-AB-29981W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29981W 100 µg
MO-AB-11006R Monoclonal Cattle (Bos taurus) WB, ELISA MO11006R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityZebrafish (Danio rerio), Cattle (Bos taurus), Dog (Canis lupus familiaris)
CloneMO72539FYA
SpecificityThis antibody binds to Zebrafish cyba.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationPlasma Membrane

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYBA (Cytochrome B-245 Alpha Chain) is a Protein Coding gene. Diseases associated with CYBA include Granulomatous Disease, Chronic, Autosomal Recessive, Cytochrome B-Negative and Chronic Granulomatous Disease. Among its related pathways are Innate Immune System and RET signaling. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and SH3 domain binding.
Product OverviewMouse Anti-Zebrafish cyba Antibody is a mouse antibody against cyba. It can be used for cyba detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b-245, alpha polypeptide; cyb
UniProt IDQ6PH62
Protein RefseqThe length of the protein is 185 amino acids long.
The sequence is show below: MAKIEWAMWANEQALAAGLIYLTGGIVGVAGQFRGWQFAAFGIAAGVFVCLLEYPRSKRGKGTSIERSGQYCFTVCVKSFGPLTRNYYVRAFLHAALCVPGGFMLATVLGCVCLGMASLIYLSAAIHGEHWEPILHIETKKRLGESIKEPPQNPPPRPPPELRRKKADNLDAAAYDNPMSVTINE.
For Research Use Only | Not For Clinical Use.
Online Inquiry