AibGenesis™ Mouse Anti-CYBA Antibody (MO-AB-41499W)


Cat: MO-AB-41499W

Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-41499W Monoclonal Guinea pig (Cavia porcellus), Cattle (Bos taurus), Dog (Canis lupus familiaris) WB, ELISA MO41499W 100 µg
MO-AB-29981W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29981W 100 µg
MO-AB-11006R Monoclonal Cattle (Bos taurus) WB, ELISA MO11006R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGuinea pig (Cavia porcellus), Cattle (Bos taurus), Dog (Canis lupus familiaris)
CloneMO41499W
SpecificityThis antibody binds to Guinea pig CYBA.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

Product OverviewMouse Anti-Guinea pig CYBA Antibody is a mouse antibody against CYBA. It can be used for CYBA detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesFlavocytochrome b-558 alpha polypeptide; CYBA
UniProt IDQ76EV6
Protein RefseqThe length of the protein is105 amino acids long.
The sequence is show below: WANEQALASGLILVAGGIVATVGRFAQWYFGAYSIAAGALVCLLEYPRGRRRKGSTMERCGQKYVAAAVKLFGPLTRNYYVRAVLHLLLSVPAGFLLATILGTVC.
For Research Use Only | Not For Clinical Use.
Online Inquiry