Mouse Anti-Cyba Antibody (MO-AB-25232H)


Cat: MO-AB-25232H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

  • Product List
  • Specifications
  • Application Information
  • Target
Sub Cat Clonality Species Reactivity Application Clone Conjugate Size  
MO-AB-25232H Monoclonal Rat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris) WB, ELISA MO25232C 100 µg
MO-AB-29981W Monoclonal Dog (Canis lupus familiaris) WB, ELISA MO29981W 100 µg
MO-AB-11006R Monoclonal Cattle (Bos taurus) WB, ELISA MO11006R 100 µg

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityRat (Rattus norvegicus), Cattle (Bos taurus), Dog (Canis lupus familiaris)
CloneMO25232C
SpecificityThis antibody binds to Rat Cyba.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationOther locations; Cytoskeleton; Plasma membrane; Endosome; Golgi apparatus; Nucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCYBA (Cytochrome B-245 Alpha Chain) is a protein coding gene. Diseases associated with CYBA include Granulomatous Disease, Chronic, Autosomal Recessive, Cytochrome B-Negative and Chronic Granulomatous Disease. Among its related pathways are Innate Immune System and RET signaling. Gene Ontology (GO) annotations related to this gene include protein heterodimerization activity and SH3 domain binding.
Product OverviewThis product is a mouse antibody against Cyba. It can be used for Cyba detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesCytochrome b-245 light chain; Cytochrome b(558) alpha chain; Cytochrome b558 subunit alpha; Neutrophil cytochrome b 22 kDa polypeptide; Superoxide-generating NADPH oxidase light chain subunit; p22 phagocyte B-cytochrome; p22-phox; p22phox; Cyba
UniProt IDQ62737
Protein RefseqThe length of the protein is 192 amino acids long.
The sequence is show below: MGQIEWAMWANEQALASGLILITGGIVATAGRFTQWYFGAYSIVAGVLICLLEYPRGKRKKGSTMERCGQKYLTAVVKLFGPLTRNYYVRAVLHLLLSVPAGFLLATILGTVCLAIASVIYLLAAIRGEQWTPIEPKPKERPQVGGTIKQPPTNPPPRPPAEVRKKPSEAEEEAASAGGPQVNPIPVTDEVV.
For Research Use Only | Not For Clinical Use.
Online Inquiry