Mouse Anti-Elephant S100B Antibody (MO-AB-01317L)
Cat: MO-AB-01317L
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Elephant (Loxodonta africana) |
Clone | MO01317L |
Specificity | This antibody binds to Elephant S100B. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Cytosol; Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a member of the S100 family of proteins containing 2 EF-hand calcium-binding motifs. S100 proteins are localized in the cytoplasm and/or nucleus of a wide range of cells, and involved in the regulation of a number of cellular processes such as cell cycle progression and differentiation. S100 genes include at least 13 members which are located as a cluster on chromosome 1q21; however, this gene is located at 21q22.3. This protein may function in Neurite extension, proliferation of melanoma cells, stimulation of Ca2+ fluxes, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. Chromosomal rearrangements and altered expression of this gene have been implicated in several neurological, neoplastic, and other types of diseases, including Alzheimer's disease, Down's syndrome, epilepsy, amyotrophic lateral sclerosis, melanoma, and type I diabetes. |
Product Overview | This product is a mouse antibody against S100B. It can be used for S100B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Protein S100; S100 calcium-binding protein; S100B |
UniProt ID | G3TE57 |
Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: MSELEKAMVSLIDVFHQYSGKEGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMVTTACHEFFEHE. |
See other products for " S100B "
MO-AB-09518W | Mouse Anti-Cat S100B Antibody (MO-AB-09518W) |
MO-AB-09816Y | Mouse Anti-Rabbit S100B Antibody (MO-AB-09816Y) |
MOFY-0622-FY172 | Rabbit Anti-S100B Antibody (MOFY-0622-FY172) |
MO-AB-19699R | Mouse Anti-Cattle S100B Antibody (MO-AB-19699R) |
MO-AB-33221W | Mouse Anti-Dog S100B Antibody (MO-AB-33221W) |
MOF032922W125 | Rabbit Anti-S100B Antibody (MOF032922W125) |
MO-AB-63755W | Mouse Anti-Marmoset S100B Antibody (MO-AB-63755W) |
CBMOAB-96970FYA | Mouse Anti-Zebrafish s100b Antibody (CBMOAB-96970FYA) |
MOFY-1222-FY100 | Rabbit Anti-S100B Antibody (MOFY-1222-FY100) |
MO-AB-28799H | Mouse Anti-Rat S100b Antibody (MO-AB-28799H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry