Mouse Anti-Rabbit S100B Antibody (MO-AB-09816Y)
Cat: MO-AB-09816Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Rabbit (Oryctolagus cuniculus) |
| Clone | MO09816Y |
| Specificity | This antibody binds to Rabbit S100B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Other locations; Nucleus |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | Weakly binds calcium but binds zinc very tightly-distinct binding sites with different affinities exist for both ions on each monomer. Physiological concentrations of potassium ion antagonize the binding of both divalent cations, especially affecting high-affinity calcium-binding sites. Binds to and initiates the activation of STK38 by releasing autoinhibitory intramolecular interactions within the kinase. Interaction with AGER after myocardial infarction may play a role in myocyte apoptosis by activating ERK1/2 and p53/TP53 signaling. Could assist ATAD3A cytoplasmic processing, preventing aggregation and favoring mitochondrial localization. May mediate calcium-dependent regulation on many physiological processes by interacting with other proteins, such as TPR-containing proteins, and modulating their activity (By similarity). |
| Product Overview | This product is a mouse antibody against S100B. It can be used for S100B detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; S100B |
| UniProt ID | Q6YNR6 |
| Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: MSELEKAMVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDNDGDGECDFQEFMAFVAMVTTACHEFFEHE. |
See other products for " S100B "
| MO-AB-63755W | Mouse Anti-Marmoset S100B Antibody (MO-AB-63755W) |
| MO-AB-01317L | Mouse Anti-Elephant S100B Antibody (MO-AB-01317L) |
| MO-AB-17554Y | Mouse Anti-Sheep S100B Antibody (MO-AB-17554Y) |
| MOFY-1222-FY100 | Rabbit Anti-S100B Antibody (MOFY-1222-FY100) |
| MO-AB-46425W | Mouse Anti-Horse S100B Antibody (MO-AB-46425W) |
| MO-AB-38142W | Mouse Anti-Goat S100B Antibody (MO-AB-38142W) |
| CBMOAB-57042FYA | Mouse Anti-Rhesus S100B Antibody (CBMOAB-57042FYA) |
| MO-NAB-00409W | Rabbit Anti-S100B Antibody (C-terminal) |
| CBMOAB-96970FYA | Mouse Anti-Zebrafish s100b Antibody (CBMOAB-96970FYA) |
| MO-AB-09518W | Mouse Anti-Cat S100B Antibody (MO-AB-09518W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry