Mouse Anti-Cattle S100B Antibody (MO-AB-19699R)
Cat: MO-AB-19699R
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
| Size: | |
| Conjugate: | |
| Inquiry |
- Product Details
Specifications
| Host species | Mouse (Mus musculus) |
| Species Reactivity | Cattle (Bos taurus) |
| Clone | MO19699R |
| Specificity | This antibody binds to Cattle S100B. |
| Format | Liquid or Lyophilized |
| Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
| Purity | > 90% was determined by SDS-PAGE |
| Purification | Purified with Protein A or G affinity chromatography |
| Cellular Localization | Cytosol; Nucleus; Other locations |
Application Information
| Application | WB, ELISA |
| Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
| Introduction | S100 calcium binding protein B (S100B) is a protein of the S-100 protein family.S100 protein is located in the cytoplasm and nucleus of a large number of cells and participates in the regulation of many cellular processes, such as cell cycle progression and differentiation. The S100 gene includes at least 13 members clustered on chromosome 1q21. However, the gene is located at 21q22.3.S100B is glial-specific and is mainly expressed by astrocytes, but not all astrocytes express S100B. It has been shown that S100B is expressed only by mature astrocyte subtypes that surround blood vessels and cells expressing NG2. The protein may play a role in neurite outgrowth, melanoma cell proliferation, Ca2+ flux stimulation, inhibition of PKC-mediated phosphorylation, astrocytosis and axonal proliferation, and inhibition of microtubule assembly. In the developing central nervous system, it acts as a neurotrophic factor and neuronal survival protein. In adult organisms, it is usually elevated due to damage to the nervous system, which makes it a potential clinical marker. |
| Product Overview | This product is a mouse antibody against S100B. It can be used for S100B detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
| Alternative Names | Protein S100-B; S-100 protein beta chain; S-100 protein subunit beta; S100 calcium-binding protein B; S100B |
| UniProt ID | P02638 |
| Protein Refseq | The length of the protein is 92 amino acids long. The sequence is show below: MSELEKAVVALIDVFHQYSGREGDKHKLKKSELKELINNELSHFLEEIKEQEVVDKVMETLDSDGDGECDFQEFMAFVAMITTACHEFFEHE. |
See other products for " S100B "
| MOFY-0622-FY172 | Rabbit Anti-S100B Antibody (MOFY-0622-FY172) |
| MO-AB-28799H | Mouse Anti-Rat S100b Antibody (MO-AB-28799H) |
| MO-NAB-00409W | Rabbit Anti-S100B Antibody (C-terminal) |
| CBMOAB-57042FYA | Mouse Anti-Rhesus S100B Antibody (CBMOAB-57042FYA) |
| MO-AB-17554Y | Mouse Anti-Sheep S100B Antibody (MO-AB-17554Y) |
| MO-AB-01317L | Mouse Anti-Elephant S100B Antibody (MO-AB-01317L) |
| MO-AB-35626W | Mouse Anti-Ferret S100B Antibody (MO-AB-35626W) |
| MOFAB-018W | Rabbit Anti-S100B Antibody (MOFAB-018W) |
| MO-AB-09518W | Mouse Anti-Cat S100B Antibody (MO-AB-09518W) |
| MO-AB-63755W | Mouse Anti-Marmoset S100B Antibody (MO-AB-63755W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry