Mouse Anti-Ferret Casp3 Antibody (MO-AB-34481W)
Cat: MO-AB-34481W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Ferret (Mustela Putorius Furo) |
Clone | MO34481W |
Specificity | This antibody binds to Ferret Casp3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | The protein encoded by this gene is a cysteine-aspartic acid protease that plays a central role in the execution-phase of cell apoptosis. The encoded protein cleaves and inactivates poly(ADP-ribose) polymerase while it cleaves and activates sterol regulatory element binding proteins as well as caspases 6, 7, and 9. This protein itself is processed by caspases 8, 9, and 10. It is the predominant caspase involved in the cleavage of amyloid-beta 4A precursor protein, which is associated with neuronal death in Alzheimer's disease. |
Product Overview | Mouse Anti-Ferret Casp3 Antibody is a mouse antibody against Casp3. It can be used for Casp3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | Caspase 3; Casp3 |
UniProt ID | D7F095 |
Protein Refseq | The length of the protein is 74 amino acids long. The sequence is show below: LLSHGDEGIIFGTNGPVDLKKLTGFFRGDYCRSLTGKPKLFIIQACRGTDLDCGIETDSGAEDDMACQKIPVEA. |
See other products for " CASP3 "
MO-AB-09514R | Mouse Anti-Cattle CASP3 Antibody (MO-AB-09514R) |
CBMOAB-38178FYA | Mouse Anti-Rhesus CASP3 Antibody (CBMOAB-38178FYA) |
MO-AB-10800Y | Mouse Anti-O. mykiss Casp3 Antibody (MO-AB-10800Y) |
MO-AB-16426W | Mouse Anti-Chimpanzee CASP3 Antibody (MO-AB-16426W) |
MO-AB-00983Y | Mouse Anti-Chicken CASP3 Antibody (MO-AB-00983Y) |
MO-AB-29335W | Mouse Anti-Dog CASP3 Antibody (MO-AB-29335W) |
MO-AB-14446Y | Mouse Anti-Sheep CASP3 Antibody (MO-AB-14446Y) |
MOFAB-043W | Rabbit Anti-CASP3 Antibody (MOFAB-043W) |
CBMOAB-25710FYC | Mouse Anti-Arabidopsis CASP3 Antibody (CBMOAB-25710FYC) |
MO-AB-36856W | Mouse Anti-Goat CASP3 Antibody (MO-AB-36856W) |
For Research Use Only | Not For Clinical Use.
Online Inquiry