Mouse Anti-Frog ddit3 Antibody (MO-AB-02913H)


Cat: MO-AB-02913H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO02913C
SpecificityThis antibody binds to Frog ddit3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.
Product OverviewThis product is a mouse antibody against ddit3. It can be used for ddit3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesTranscription factor GADD153; ddit3; gadd153
UniProt IDQ7T2S7
Protein RefseqThe length of the protein is 211 amino acids long.
The sequence is show below: MMAESLPFCGPTGTLSGWELEAWYEDLQDILWADTKGAGNLLPVVSEQEILQLETVDHSPYIWSTESPLLVDINNEDSDALEAAVQQLPSAILELINSEIQDSCNVSASPKSEDTQQPEVPELDYCSSSSVHTYTEDEEPCASQPTLKRKRSSPSRGGKVRVKEKEEENEKKVSHLLAENERLKGEIERLSKEVEQTRKALIDRMVNLKKD.
See other products for " Ddit3 "
MO-AB-25313HMouse Anti-Rat Ddit3 Antibody (MO-AB-25313H)
MO-AB-34659WMouse Anti-Ferret DDIT3 Antibody (MO-AB-34659W)
MO-AB-43068WMouse Anti-Hamsters DDIT3 Antibody (MO-AB-43068W)
MO-AB-44352WMouse Anti-Horse DDIT3 Antibody (MO-AB-44352W)
MO-AB-00345LMouse Anti-Elephant DDIT3 Antibody (MO-AB-00345L)
MO-AB-30117WMouse Anti-Dog DDIT3 Antibody (MO-AB-30117W)
MO-AB-11267RMouse Anti-Cattle DDIT3 Antibody (MO-AB-11267R)
CBMOAB-73134FYAMouse Anti-Zebrafish ddit3 Antibody (CBMOAB-73134FYA)
MO-AB-37115WMouse Anti-Goat DDIT3 Antibody (MO-AB-37115W)
MO-AB-16350WMouse Anti-Chimpanzee DDIT3 Antibody (MO-AB-16350W)
For Research Use Only | Not For Clinical Use.
Online Inquiry