Mouse Anti-Horse DDIT3 Antibody (MO-AB-44352W)
Cat: MO-AB-44352W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Horse (Equus caballus) |
Clone | MO44352W |
Specificity | This antibody binds to Horse DDIT3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Endosome; Nucleus; Other locations |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | This gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified. |
Product Overview | Mouse Anti-Horse DDIT3 Antibody is a mouse antibody against DDIT3. It can be used for DDIT3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay. |
Alternative Names | DNA damage-inducible transcript 3 protein; DDIT-3; C / EBP zeta; C / EBP-homologous protein; C / EBP-homologous protein 10; CCAAT / enhancer-binding protein homologous protein; Growth arrest and DNA-damage-inducible protein GADD153; DDIT3 |
UniProt ID | F7DZI6 |
Protein Refseq | The length of the protein is168 amino acids long. The sequence is show below: MAAEPLPFSFGTLSSWELEAWYEDLQEVLFSDENGGTYVSPPGNEEEESKTFTTLDPASLAWLTEEPGPAEVTSTSQSPRSPDSSQSSLAQEEEEEDQVRPRKRKQSGQSPARAGKQRMKEKEQENERKVAKLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA. |
See other products for " ddit3 "
MO-AB-02913H | Mouse Anti-Frog ddit3 Antibody (MO-AB-02913H) |
MO-AB-43068W | Mouse Anti-Hamsters DDIT3 Antibody (MO-AB-43068W) |
CBMOAB-73134FYA | Mouse Anti-Zebrafish ddit3 Antibody (CBMOAB-73134FYA) |
MO-AB-54013W | Mouse Anti-Marmoset DDIT3 Antibody (MO-AB-54013W) |
MO-AB-38522W | Mouse Anti-Gorilla DDIT3 Antibody (MO-AB-38522W) |
MO-AB-14925Y | Mouse Anti-Sheep DDIT3 Antibody (MO-AB-14925Y) |
MO-AB-16350W | Mouse Anti-Chimpanzee DDIT3 Antibody (MO-AB-16350W) |
MO-AB-07877Y | Mouse Anti-Rabbit DDIT3 Antibody (MO-AB-07877Y) |
MO-AB-25317R | Mouse Anti-Pig Ddit3 Antibody (MO-AB-25317R) |
MO-AB-11267R | Mouse Anti-Cattle DDIT3 Antibody (MO-AB-11267R) |
For Research Use Only | Not For Clinical Use.
Online Inquiry