Mouse Anti-Rabbit DDIT3 Antibody (MO-AB-07877Y)
Cat: MO-AB-07877Y
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number
Size: | |
Conjugate: | |
Inquiry |
- Product Details
Specifications
Host species | Mouse (Mus musculus) |
Species Reactivity | Rabbit (Oryctolagus cuniculus) |
Clone | MO07877Y |
Specificity | This antibody binds to Rabbit DDIT3. |
Format | Liquid or Lyophilized |
Storage | Store at 4°C: short-term (1-2weeks) Store at -20°C: long-term and future use |
Purity | > 90% was determined by SDS-PAGE |
Purification | Purified with Protein A or G affinity chromatography |
Cellular Localization | Other locations; Endosome; Nucleus |
Application Information
Application | WB, ELISA |
Application Notes | ELISA: 1:1000-1:3000 Other applications are to be developed. The optimal dilution should be determined by the end user. |
Target
Introduction | Multifunctional transcription factor in ER stress response. Plays an essential role in the response to a wide variety of cell stresses and induces cell cycle arrest and apoptosis in response to ER stress. Plays a dual role both as an inhibitor of CCAAT/enhancer-binding protein (C/EBP) function and as an activator of other genes. Acts as a dominant-negative regulator of C/EBP-induced transcription: dimerizes with members of the C/EBP family, impairs their association with C/EBP binding sites in the promoter regions, and inhibits the expression of C/EBP regulated genes. Positively regulates the transcription of TRIB3, IL6, IL8, IL23, TNFRSF10B/DR5, PPP1R15A/GADD34, BBC3/PUMA, BCL2L11/BIM and ERO1L. Negatively regulates; expression of BCL2 and MYOD1, ATF4-dependent transcriptional activation of asparagine synthetase (ASNS), CEBPA-dependent transcriptional activation of hepcidin (HAMP) and CEBPB-mediated expression of peroxisome proliferator-activated receptor gamma (PPARG). Inhibits the canonical Wnt signaling pathway by binding to TCF7L2/TCF4, impairing its DNA-binding properties and repressing its transcriptional activity. Plays a regulatory role in the inflammatory response through the induction of caspase-11 (CASP4/CASP11) which induces the activation of caspase-1 (CASP1) and both these caspases increase the activation of pro-IL1B to mature IL1B which is involved in the inflammatory response. |
Product Overview | This product is a mouse antibody against DDIT3. It can be used for DDIT3 detection in Western Blot and Enzyme-Linked Immunosorbent Assay. |
Alternative Names | DNA damage-inducible transcript 3 protein; DDIT-3; C/EBP zeta; C/EBP-homologous protein; C/EBP-homologous protein 10; CCAAT/enhancer-binding protein homologous protein; Growth arrest and DNA-damage-inducible protein GADD153; DDIT3 |
UniProt ID | G1TI15 |
Protein Refseq | The length of the protein is 168 amino acids long. The sequence is show below: MAAESLPFSFGTVSSWELEAWYEDLQEVLSSDENGGTYVSPPGNEEEEPKTFTTLDPASLAWLAEEPGPAEATSTSLSPRSPESSQSSLAQEEEEEDRGRTRKRKQSGQCAARAGKQRMKEKEQENERRVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA. |
See other products for " DDIT3 "
MO-AB-00345L | Mouse Anti-Elephant DDIT3 Antibody (MO-AB-00345L) |
MO-AB-43068W | Mouse Anti-Hamsters DDIT3 Antibody (MO-AB-43068W) |
MO-AB-11267R | Mouse Anti-Cattle DDIT3 Antibody (MO-AB-11267R) |
MO-AB-44352W | Mouse Anti-Horse DDIT3 Antibody (MO-AB-44352W) |
MO-AB-14925Y | Mouse Anti-Sheep DDIT3 Antibody (MO-AB-14925Y) |
CBMOAB-73134FYA | Mouse Anti-Zebrafish ddit3 Antibody (CBMOAB-73134FYA) |
MO-AB-30117W | Mouse Anti-Dog DDIT3 Antibody (MO-AB-30117W) |
MO-AB-02913H | Mouse Anti-Frog ddit3 Antibody (MO-AB-02913H) |
MO-AB-16350W | Mouse Anti-Chimpanzee DDIT3 Antibody (MO-AB-16350W) |
MO-AB-25313H | Mouse Anti-Rat Ddit3 Antibody (MO-AB-25313H) |
For Research Use Only | Not For Clinical Use.
Online Inquiry