Mouse Anti-Ferret DDIT3 Antibody (MO-AB-34659W)


Cat: MO-AB-34659W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFerret (Mustela Putorius Furo)
CloneMO34659W
SpecificityThis antibody binds to Ferret DDIT3.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationEndosome; Nucleus; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionThis gene encodes a member of the CCAAT/enhancer-binding protein (C/EBP) family of transcription factors. The protein functions as a dominant-negative inhibitor by forming heterodimers with other C/EBP members, such as C/EBP and LAP (liver activator protein), and preventing their DNA binding activity. The protein is implicated in adipogenesis and erythropoiesis, is activated by endoplasmic reticulum stress, and promotes apoptosis. Fusion of this gene and FUS on chromosome 16 or EWSR1 on chromosome 22 induced by translocation generates chimeric proteins in myxoid liposarcomas or Ewing sarcoma. Multiple alternatively spliced transcript variants encoding two isoforms with different length have been identified.
Product OverviewMouse Anti-Ferret DDIT3 Antibody is a mouse antibody against DDIT3. It can be used for DDIT3 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesDNA damage-inducible transcript 3 protein; DDIT-3; C / EBP zeta; C / EBP-homologous protein; C / EBP-homologous protein 10; CCAAT / enhancer-binding protein homologous protein; Growth arrest and DNA-damage-inducible protein GADD153; DDIT3
UniProt IDM3XRW7
Protein RefseqThe length of the protein is 168 amino acids long.
The sequence is show below: MAAESLPFSFGTLSSWELEAWYEDLQEVLSSDENGGTYISPSGNKEEESETFTTLDPASLAWLTEEPGPAEVTNSSQSPRSPDSSQSSLAQEEEEEDQRRPRKRKQSGQSPAVAGKQRMKEKEQENERKVAQLAEENERLKQEIERLTREVEATRRALIDRMVNLHQA.
For Research Use Only | Not For Clinical Use.
Online Inquiry