Mouse Anti-Frog mbd2 Antibody (MO-AB-05060H)


Cat: MO-AB-05060H
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityFrog (Xenopus laevis)
CloneMO05060C
SpecificityThis antibody binds to Frog mbd2.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationNucleus

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionDNA methylation is the major modification of eukaryotic genomes and plays an essential role in mammalian development. Human proteins MECP2, MBD1, MBD2, MBD3, and MBD4 comprise a family of nuclear proteins related by the presence in each of a methyl-CpG binding domain (MBD). Each of these proteins, with the exception of MBD3, is capable of binding specifically to methylated DNA. MECP2, MBD1 and MBD2 can also repress transcription from methylated gene promoters. The protein encoded by this gene may function as a mediator of the biological consequences of the methylation signal. It is also reported that the this protein functions as a demethylase to activate transcription, as DNA methylation causes gene silencing. Two transcript variants encoding different isoforms have been found for this gene.
Product OverviewThis product is a mouse antibody against mbd2. It can be used for mbd2 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMethyl-CpG binding protein MBD2; mbd2; MBD2
UniProt IDQ8AYT1
Protein RefseqThe length of the protein is 267 amino acids long.
The sequence is show below: MEKRRLECPALPAGWKKEEVIRKSGLSAGKSDVYYYSPNGKKFRSKPQLARYLGNSVDLNSFDFRTGKMMPSKLQKNKQRLRNDPLNQNKSKPDLNTTLPIRQTASIFKQPVTKITNHPSNKVKSDPQRVIEQPRQLFWEKRLEGLSASDVTEQVLKPMELPKGLQGVGPRNNEETLLAAIASALHTSSAPITGQLSATVEKNPSVWLNTFQPLCKAFLVTDEDIRKQEDKVQNVRRRLEEALMADILARDSEASQNSDIYMDSRDD.
For Research Use Only | Not For Clinical Use.
Online Inquiry