Mouse Anti-Gorilla CD14 Antibody (MO-AB-38463W)


Cat: MO-AB-38463W
Certificate of Analysis Lookup
To download a Certificate of Analysis, please enter a lot number in the search box below. Note: Certificate of Analysis not available for kit components.
Lot Number

Size:
Conjugate:
 Inquiry
  • Product Details

Specifications

Host speciesMouse (Mus musculus)
Species ReactivityGorilla
CloneMO38463W
SpecificityThis antibody binds to Gorilla CD14.
FormatLiquid or Lyophilized
StorageStore at 4°C: short-term (1-2weeks)
Store at -20°C: long-term and future use
Purity> 90% was determined by SDS-PAGE
PurificationPurified with Protein A or G affinity chromatography
Cellular LocalizationGolgi apparatus; Plasma membrane; Other locations

Application Information

ApplicationWB, ELISA
Application NotesELISA: 1:1000-1:3000
Other applications are to be developed. The optimal dilution should be determined by the end user.

Target

IntroductionCD14 (CD14 Molecule) is a Protein Coding gene. Diseases associated with CD14 include Mycobacterium Chelonae and Croup. Among its related pathways are Bacterial infections in CF airways and Development Slit-Robo signaling. Gene Ontology (GO) annotations related to this gene include lipopolysaccharide binding and lipoteichoic acid binding.
Product OverviewMouse Anti-Gorilla CD14 Antibody is a mouse antibody against CD14. It can be used for CD14 detection in Western Blot, Enzyme-Linked Immunosorbent Assay.
Alternative NamesMonocyte differentiation antigen CD14; Myeloid cell-specific leucine-rich glycoprotein; CD14
UniProt IDG3R4C0
Protein RefseqThe length of the protein is 375 amino acids long.
The sequence is show below: MGRASCLLLLLLPLVHVSATTPEPCELDDEDFRCVCNFSEPQPDWSEAFQCVSAVEVEIRAGGLNLEPFLKRVDADADPRQYADTVKALRVRRLTVGAAQVPAQLLVGALRVLAYSRLKELTLEDLKITGTMPPLPLEATGLALSSLRLRNVSWATGRSWLAELQQWLKPGLKVLSIAQAHSPAFSCEQVRAFPALTSLDLSDNPGLGERGLIAALCPHKFPAIQNLALRNTGMETPTGVCAALAAAGVQPHSLDLSHNSLRATVNPSAPRCMWSSALNSLNLSFAGLEQVPKGLPAKLRVLDLSCNRLNRAPQPDELPEVDNLTLDGNPFLVPGTALPHEGSMNSGVVPACARSTLSVGVSGTLVLLQGARGFA.
See other products for " CD14 "
MO-AB-43979WMouse Anti-Horse CD14 Antibody (MO-AB-43979W)
MO-AB-24426RMouse Anti-Pig CD14 Antibody (MO-AB-24426R)
MO-AB-01043YMouse Anti-Chicken Cd14 Antibody (MO-AB-01043Y)
CBMOAB-00021FYAMouse Anti-Cattle CD14 Antibody (CBMOAB-00021FYA)
MOFY-0522-FY63Mouse Anti-CD14 Antibody (MOFY-0522-FY63)
MO-AB-52526WMouse Anti-Marmoset CD14 Antibody (MO-AB-52526W)
MO-AB-34512WMouse Anti-Ferret CD14 Antibody (MO-AB-34512W)
MO-AB-16680WMouse Anti-Chimpanzee CD14 Antibody (MO-AB-16680W)
MO-AB-29439WMouse Anti-Dog CD14 Antibody (MO-AB-29439W)
CBMOAB-38622FYAMouse Anti-Rhesus CD14 Antibody (CBMOAB-38622FYA)
For Research Use Only | Not For Clinical Use.
Online Inquiry